BioLiP

>protein
MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFKASEAAIPAPERVAAMLPERARWAEENGLDAPFVEGLFA
QIIHWYIAEQIKYWRQTRGA

The query sequence (length=100) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2h9d:D	100	100	1.0000	1.0000	1.0000	3.51e-70	2h9c:A, 2h9c:B, 2h9d:B, 2h9d:C, 3hgw:D, 3hgx:A, 3rem:A, 3rem:B, 3ret:B
2	2h9d:A	84	94	0.8400	1.0000	0.8936	3.29e-55
3	7aor:z	1071	42	0.1800	0.0168	0.4286	0.21
4	6hiv:Cv	1059	38	0.1700	0.0161	0.4474	0.60	6hiw:Cv, 6hiy:Cv, 7pub:Cv
5	4ll2:B	224	69	0.1800	0.0804	0.2609	0.65	4oei:A, 4oei:B, 3s18:A, 3s18:B, 3v6n:A, 3v6n:B, 4yeh:A, 4yeh:B
6	7rj1:A	265	46	0.1500	0.0566	0.3261	0.71	7rj1:B, 7rj1:C, 7rj1:D
7	5en7:A	177	31	0.1000	0.0565	0.3226	3.2	5en6:A, 5en7:C, 5en7:E, 5en7:G
8	6q8j:A	188	31	0.1000	0.0532	0.3226	4.7
9	4iqj:A	1164	28	0.1300	0.0112	0.4643	5.2
10	4iqj:D	1185	28	0.1300	0.0110	0.4643	5.2	3e0d:A, 3e0d:B, 2hpi:A, 2hpm:A, 4iqj:B, 4iqj:C
11	7stm:A	801	45	0.1200	0.0150	0.2667	7.9	7stm:B, 7stn:A, 7stn:B, 7sto:B, 7sto:A
12	3aib:G	844	33	0.1200	0.0142	0.3636	10.0	3aib:A, 3aib:B, 3aib:C, 3aib:D, 3aib:E, 3aib:F, 3aib:H, 3aic:A, 3aic:B, 3aic:C, 3aic:D, 3aic:E, 3aic:F, 3aic:G, 3aic:H, 3aie:A, 3aie:B, 3aie:C, 3aie:D, 3aie:E, 3aie:F, 3aie:G, 3aie:H, 8fg8:A, 8fg8:B, 8fj9:A, 8fj9:B, 8fjc:A, 8fjc:B, 8fk4:A, 8fk4:B, 8fk4:C, 8fk4:D, 8fk4:E, 8fk4:F, 8fk4:G, 8fk4:H, 8uf5:A, 8uf5:B

[Back]