MKTIKMVADELNVTKQTVVNNAKNLNISFEKENGVNYIDDNDYLKIVEKITKK
The query sequence (length=53) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8csh:D | 53 | 53 | 1.0000 | 1.0000 | 1.0000 | 3.67e-31 | 8csh:A |
2 | 5i44:B | 68 | 48 | 0.2830 | 0.2206 | 0.3125 | 0.21 | 5i44:A, 5i44:D, 5i44:E, 5i44:H, 5i44:J, 5i44:K, 5i44:G, 5i44:F, 5i44:I |
3 | 1t10:A | 556 | 37 | 0.2453 | 0.0234 | 0.3514 | 1.9 | |
4 | 5jsd:A | 548 | 45 | 0.2642 | 0.0255 | 0.3111 | 4.8 | 5jsd:B, 5jsd:C, 5jse:A, 5jse:B, 5jse:C |
5 | 8cls:A | 837 | 35 | 0.2264 | 0.0143 | 0.3429 | 5.6 | |
6 | 8cls:B | 853 | 35 | 0.2264 | 0.0141 | 0.3429 | 5.7 | |
7 | 8bx8:A | 4453 | 23 | 0.1509 | 0.0018 | 0.3478 | 7.2 | 7k58:A, 7k5b:A, 7kek:A |
8 | 5xxu:X | 135 | 25 | 0.1509 | 0.0593 | 0.3200 | 7.7 | |
9 | 2oox:E | 333 | 54 | 0.3019 | 0.0480 | 0.2963 | 9.5 | 2oox:G, 2ooy:G, 2ooy:E, 2qr1:G, 2qr1:E, 2qrc:G, 2qrc:E, 2qrd:G, 2qrd:E, 2qre:G, 2qre:E |