MKRTTLDSPLGKLELSGCEQGLHEIKLLGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVV
KFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGH
The query sequence (length=148) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1eh6:A | 168 | 159 | 1.0000 | 0.8810 | 0.9308 | 3.37e-104 | 1eh7:A, 1eh8:A, 1t38:A, 1t39:A, 1t39:B, 1yfh:C, 1yfh:A, 1yfh:B |
2 | 3kzy:A | 162 | 154 | 0.8716 | 0.7963 | 0.8377 | 2.47e-88 | 3kzy:B, 3kzz:A, 3l00:A, 6y8p:A |
3 | 4wx9:A | 161 | 153 | 0.3919 | 0.3602 | 0.3791 | 2.20e-21 | |
4 | 6ga0:A | 154 | 141 | 0.2703 | 0.2597 | 0.2837 | 1.79e-11 | |
5 | 7e1p:A | 150 | 143 | 0.2973 | 0.2933 | 0.3077 | 2.21e-10 | 7dqq:A |
6 | 4enj:A | 108 | 70 | 0.1554 | 0.2130 | 0.3286 | 9.89e-05 | 4enk:A, 4enm:A, 4enn:A, 4enn:B, 3gx4:X, 3gyh:X, 4hdu:A, 4hdv:A |
7 | 2p3i:A | 161 | 29 | 0.0811 | 0.0745 | 0.4138 | 5.4 | 1kqr:A, 2p3j:A, 2p3k:A, 3tb0:A |
8 | 5xu6:C | 379 | 43 | 0.0946 | 0.0369 | 0.3256 | 6.6 | 5xu6:A, 5xu6:B, 5xu6:D |
9 | 8vc5:A | 488 | 76 | 0.1419 | 0.0430 | 0.2763 | 6.6 | 8vc5:B |
10 | 5olu:A | 310 | 32 | 0.0811 | 0.0387 | 0.3750 | 8.6 |