BioLiP

>protein
MKRPKLKKASKRMTCHKRYKIQKKVREHHRKLRKEAKKDPGVPNSAPFKEALLREAELRKQRLEELKQ

The query sequence (length=68) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8fl2:NB	81	76	1.0000	0.8395	0.8947	2.06e-39	8fl3:NB, 8fl4:NB, 8ir1:u, 8ir3:u
2	8fkt:NB	387	68	0.9853	0.1731	0.9853	2.23e-38	8fkp:NB, 8fku:NB, 8fkv:NB, 8fkw:NB, 8fkx:NB, 8fky:NB, 8fkz:NB, 8fl0:NB, 8ink:u, 8ipd:u, 8ipx:u, 8ipy:u
3	8i9w:CL	397	65	0.4265	0.0730	0.4462	4.77e-05	8i9t:CL, 8i9v:CL, 8i9x:CL, 8i9y:CL, 8i9z:CL, 8ia0:CL, 8pv1:CL, 8pv2:CL, 8pv3:CL, 8pv4:CL, 8pv5:CL, 8pv6:CL, 8pv7:CL, 8pv8:CL, 8pvk:CL, 8pvl:CL
4	7uoo:s	72	29	0.1912	0.1806	0.4483	0.045	6elz:s, 6em5:s, 6ft6:s, 3jct:s, 6m62:s, 7nac:s, 7oh3:s, 7ohq:s, 7ohr:s, 7r7a:s, 7u0h:s, 7ug6:s, 7uqb:s, 7uqz:s, 7v08:s, 8v87:s, 6ylg:s, 6ylh:s, 6ylx:s, 6yly:s
5	6eqo:A	1804	16	0.1176	0.0044	0.5000	1.8	6eqo:B
6	7dei:B	377	26	0.1618	0.0292	0.4231	2.2	7dei:A
7	6j72:A	561	48	0.2059	0.0250	0.2917	2.5
8	7cyy:C	497	42	0.2059	0.0282	0.3333	2.8	7cx7:A, 7cx7:B, 7cx7:C, 7cx7:D, 7cx7:E, 7cx7:F, 7cyy:A, 7cyy:B, 7cyy:D, 7cyy:E, 7cyy:F
9	4r1q:E	496	42	0.2059	0.0282	0.3333	3.1	4r1p:A, 4r1p:B, 4r1p:C, 4r1p:D, 4r1p:E, 4r1p:F, 4r1q:A, 4r1q:D, 4r1q:B, 4r1q:F, 4r1q:C
10	6dtq:A	391	54	0.2353	0.0409	0.2963	3.7	6dtq:B, 6dtq:C, 6dtq:D
11	2yy5:B	346	36	0.1912	0.0376	0.3611	6.2	2yy5:A, 2yy5:C, 2yy5:D

[Back]