Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
MKRPKLKKASKRMTCHKRYKIQKKVREHHRKLRKEADPGVPNSAPFKEALLREAELRKQRLEELKQQ

The query sequence (length=67) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 8fl2:NB 81 77 1.0000 0.8272 0.8701 4.41e-39 8fl3:NB, 8fl4:NB, 8ir1:u, 8ir3:u
2 8fkt:NB 387 68 1.0000 0.1731 0.9853 1.34e-38 8fkp:NB, 8fku:NB, 8fkv:NB, 8fkw:NB, 8fkx:NB, 8fky:NB, 8fkz:NB, 8fl0:NB, 8ink:u, 8ipd:u, 8ipx:u, 8ipy:u
3 8i9w:CL 397 65 0.4030 0.0680 0.4154 5.36e-04 8i9t:CL, 8i9v:CL, 8i9x:CL, 8i9y:CL, 8i9z:CL, 8ia0:CL, 8pv1:CL, 8pv2:CL, 8pv3:CL, 8pv4:CL, 8pv5:CL, 8pv6:CL, 8pv7:CL, 8pv8:CL, 8pvk:CL, 8pvl:CL
4 7uoo:s 72 28 0.1940 0.1806 0.4643 0.050 6elz:s, 6em5:s, 6ft6:s, 3jct:s, 6m62:s, 7nac:s, 7oh3:s, 7ohq:s, 7ohr:s, 7r7a:s, 7u0h:s, 7ug6:s, 7uqb:s, 7uqz:s, 7v08:s, 8v87:s, 6ylg:s, 6ylh:s, 6ylx:s, 6yly:s
5 7dei:B 377 27 0.1642 0.0292 0.4074 1.2 7dei:A
6 8tdf:A 452 35 0.1642 0.0243 0.3143 3.4 8tdf:B, 8tdf:C, 8tdf:D, 8tdh:B, 8tdh:C, 8tdh:D, 8tdh:A

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218