MKQQEVRQRAFAMPLTSPAFPPGPYRFVNREYMIITYRTDPAAIEAVLPEPLQMAEPVVRYEFIRMPDSTGFGDYSESGQ
VIPVTFRGERGSYTLAMFLDDQPPLAGGRELWGFPKKAGKPRLEVHQDTLVGSLDFGPVRIATGTMGYKYEALDRSALLA
SLAEPNFLLKIIPHVDGSPRICELVRYHTTDVAIKGAWSAPGSLELHPHALAPVAALPVLEVLSARHFVCDLTLDLGTVV
FDYL
The query sequence (length=244) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3bh3:D | 245 | 244 | 1.0000 | 0.9959 | 1.0000 | 0.0 | 3bh3:A, 3bh3:B, 3bh3:C |
2 | 6eej:A | 264 | 250 | 0.2582 | 0.2386 | 0.2520 | 0.53 | 6eej:B, 6eej:C, 6eej:D, 4zbt:A, 4zbt:B, 4zbt:C, 4zbt:D |
3 | 7ktr:A | 3042 | 66 | 0.0984 | 0.0079 | 0.3636 | 1.4 | |
4 | 8xvg:L | 3485 | 66 | 0.0984 | 0.0069 | 0.3636 | 1.5 | 8xvv:L |
5 | 4v8p:AU | 203 | 32 | 0.0533 | 0.0640 | 0.4062 | 6.8 | 4v8p:DU, 4v8p:FU, 4v8p:HU |
6 | 4fs9:A | 384 | 57 | 0.0738 | 0.0469 | 0.3158 | 9.0 | 4fs9:B |