BioLiP

>protein
MKQFEIVIEPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKLAQIGDEINEKWPGTITSIVH
RIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVPIWKKEIWEDGSKWQGH

The query sequence (length=136) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2qie:A	136	136	1.0000	1.0000	1.0000	2.41e-97	2qie:E, 2qie:H, 2qie:K
2	2wp4:B	132	117	0.3309	0.3409	0.3846	1.85e-22
3	6nbe:N	186	42	0.1176	0.0860	0.3810	0.21	6nas:N, 6nbw:N
4	5u03:A	559	117	0.2059	0.0501	0.2393	0.80	7mgz:F, 7mgz:P, 7mgz:O, 7mgz:Q, 7mh0:A, 7mh0:B, 7mh0:C, 7mh0:D, 7mif:C, 7mif:G, 7mif:H, 7mif:I, 7mig:C, 7mig:A, 7mig:B, 7mig:E, 7mip:C, 7mip:D, 7mip:G, 7mip:I, 5u03:B, 5u03:C, 5u03:D
5	2d7d:A	621	58	0.1103	0.0242	0.2586	1.6	2nmv:A, 3v4r:B, 3v4r:A
6	1zun:B	394	48	0.1250	0.0431	0.3542	1.8
7	4a5l:A	313	42	0.1176	0.0511	0.3810	2.4	4a5l:B, 4a65:A, 4a65:B, 4cbq:A, 4cbq:B, 4ccq:A, 4ccq:B, 4ccr:A, 4ccr:B, 4ccr:C, 4up3:A, 4up3:B
8	2fdc:A	505	58	0.1029	0.0277	0.2414	2.6
9	6na4:B	448	44	0.1176	0.0357	0.3636	2.8	6na3:A, 6na3:B, 6na3:C, 6na3:D, 6na4:A, 6na4:C, 6na4:D, 6na5:A, 6na5:B, 6na5:C, 6na5:D, 6na6:A, 6na6:B, 6na6:D, 6na6:C, 6owe:A, 6owe:C, 6owe:B, 6owe:D
10	5hrf:A	178	45	0.0882	0.0674	0.2667	3.3	7cpw:A, 7cpw:B, 8e9a:A, 8e9a:B, 5hr9:A, 5hr9:B, 5hrb:A, 5hrd:A, 5hrd:B, 5hrd:C, 5hrd:D, 5hre:A, 5hrf:B, 5hrg:A, 5hrg:B, 5hrh:A, 5hrh:B, 5hri:A, 5hri:B, 5hrk:A, 5hrk:B, 5hrl:A, 5hrl:B, 8ild:A, 8ild:B, 8ile:B, 8ile:A, 8ilf:B, 8ilf:A, 8ilg:A, 8ilg:B, 8ilh:B, 8ilh:A, 8ilh:C, 8ilh:D, 8ili:A, 8ili:B, 8ili:C, 8ili:D, 2m2u:A, 2m2w:A, 5xm8:A, 5xm8:B, 5xm8:C, 5xm8:D, 5xm9:A, 5xm9:B, 5xm9:C, 5xm9:D, 5xma:A, 5xma:B
11	8fl2:NU	833	63	0.1544	0.0252	0.3333	4.1	8fl3:NU, 8fl4:NU
12	2gbx:D	170	40	0.1029	0.0824	0.3500	5.4
13	5xq3:A	901	62	0.1250	0.0189	0.2742	6.9	5xq3:B, 5xqg:A, 5xqg:B, 5xqg:C, 5xqg:D, 5xqg:E, 5xqg:F, 5xqg:G, 5xqg:H, 5xqj:A, 5xqj:B, 5xqj:C, 5xqj:D, 5xqj:E, 5xqj:F, 5xqj:G, 5xqj:H, 5xqo:A, 5xqo:B
14	4xup:A	330	72	0.1618	0.0667	0.3056	7.4	4xun:A, 4xun:B, 4xun:C, 4xuo:A, 4xuo:B, 4xup:B, 4xup:C, 4xup:D, 4xup:E, 4xup:F, 4xuq:A, 4xuq:B, 4xuq:C, 4xur:A, 4xur:B, 4xur:C, 4xut:A, 4xut:B, 4xut:C
15	3ayx:A	595	42	0.1029	0.0235	0.3333	8.5	3ayx:C, 3ayz:A, 3ayz:C, 5y34:A, 5y34:C
16	3o5b:A	479	39	0.0809	0.0230	0.2821	9.2	3o5b:B, 3o80:A, 3o8m:A

[Back]