MKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALN
The query sequence (length=68) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2nwg:A | 68 | 68 | 1.0000 | 1.0000 | 1.0000 | 3.90e-46 | 2nwg:B, 4uai:A |
2 | 1ilp:A | 71 | 46 | 0.2500 | 0.2394 | 0.3696 | 9.63e-05 | 1ilq:A, 6xmn:A |
3 | 6fgp:B | 68 | 45 | 0.2206 | 0.2206 | 0.3333 | 6.31e-04 | 1b3a:B, 1b3a:A, 5coy:A, 5dnf:C, 5dnf:D, 5dnf:I, 5dnf:A, 5dnf:F, 5dnf:G, 5dnf:H, 1u4l:A, 1u4m:A |
4 | 2ra4:B | 65 | 36 | 0.1618 | 0.1692 | 0.3056 | 0.009 | |
5 | 7f1t:A | 423 | 32 | 0.1765 | 0.0284 | 0.3750 | 0.033 | 6akx:A, 6akx:B, 6aky:A, 5d65:B, 5d65:A, 5d65:D, 4mbs:A, 4mbs:B, 5uiw:A |
6 | 4r8i:A | 68 | 17 | 0.1029 | 0.1029 | 0.4118 | 0.40 | |
7 | 2mpm:A | 74 | 62 | 0.1912 | 0.1757 | 0.2097 | 1.4 | |
8 | 2iq7:E | 339 | 28 | 0.1765 | 0.0354 | 0.4286 | 1.5 | |
9 | 4r9w:B | 64 | 62 | 0.2353 | 0.2500 | 0.2581 | 3.8 | |
10 | 5vo0:D | 159 | 37 | 0.1618 | 0.0692 | 0.2973 | 4.1 | 5vnz:A, 5vnz:D, 5vo0:A |