MKNWKTSAESILTTGPVVPVIVVKKLEHAVPMAKALVAGGVRVLNVTLRTECAVDAIRAIAKEVPEAIVGAGTVLNPQQL
AEVTEAGAQFAISPGLTEPLLKAATEGTIPLIPGISTVSELMLGMDYGLKEFKFFPAEANGGVKALQAIAGPFSQVRFCP
TGGISPANYRDYLALKSVLCIGGSWLVPADALEAGDYDRITKLAREAVEGAKL
The query sequence (length=213) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2c0a:B | 214 | 213 | 1.0000 | 0.9953 | 1.0000 | 8.68e-155 | 2c0a:C, 1eua:A, 1eua:B, 1eua:C, 1wau:A, 1wbh:B, 1wbh:C |
2 | 6ovi:A | 210 | 200 | 0.4883 | 0.4952 | 0.5200 | 6.13e-73 | 6ovi:B, 6ovi:C |
3 | 1mxs:A | 216 | 208 | 0.4413 | 0.4352 | 0.4519 | 9.73e-67 | |
4 | 5xsf:A | 209 | 199 | 0.4930 | 0.5024 | 0.5276 | 3.25e-66 | |
5 | 3vcr:A | 216 | 203 | 0.4789 | 0.4722 | 0.5025 | 8.25e-66 | 3vcr:B |
6 | 1wa3:D | 203 | 204 | 0.3146 | 0.3300 | 0.3284 | 1.07e-21 | 1wa3:A, 1wa3:B, 1wa3:C, 1wa3:E, 1wa3:F |
7 | 2v82:A | 205 | 161 | 0.1878 | 0.1951 | 0.2484 | 1.27e-10 | |
8 | 7ob6:A | 222 | 62 | 0.0939 | 0.0901 | 0.3226 | 0.039 | |
9 | 2a1y:A | 301 | 50 | 0.0798 | 0.0565 | 0.3400 | 0.30 | |
10 | 3d1l:B | 259 | 99 | 0.1362 | 0.1120 | 0.2929 | 0.35 | |
11 | 1btm:A | 251 | 47 | 0.0798 | 0.0677 | 0.3617 | 5.0 | 1btm:B, 2btm:A, 2btm:B |
12 | 7ocn:A | 690 | 80 | 0.1127 | 0.0348 | 0.3000 | 6.7 | 7ocn:B, 7ocp:A, 7ocp:B, 7ocq:A, 7ocq:B, 7ocr:A, 7ocr:B, 7ocs:A, 7ocs:B, 7ocs:C, 7ocs:D, 7oct:A, 7oct:B, 7ocu:A, 7ocu:B |
13 | 3nx3:A | 388 | 34 | 0.0704 | 0.0387 | 0.4412 | 7.2 |