BioLiP

>protein
MKNWKTSAESILTTGPVVPVIVVKKLEHAVPMAKALVAGGVRVLEVTLRTECAVDAIRAIAKEVPEAIVGAGTVLNPQQL
AEVTEAGAQFAISPGLTEPLLKAATEGTIPLIPGISTVSELMLGMDYGLKEFKFFPAEANGGVKALQAIAGPFSQVRFCP
TGGISPANYRDYLALKSVLCIGGSWLVPADALEAGDYDRITKLAREAVEGAKL

The query sequence (length=213) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2c0a:B	214	213	0.9953	0.9907	0.9953	1.30e-153	2c0a:C, 1eua:A, 1eua:B, 1eua:C, 1wau:A, 1wbh:B, 1wbh:C
2	6ovi:A	210	200	0.4930	0.5000	0.5250	1.08e-73	6ovi:B, 6ovi:C
3	1mxs:A	216	208	0.4460	0.4398	0.4567	1.66e-67
4	5xsf:A	209	199	0.4977	0.5072	0.5327	4.62e-67
5	3vcr:A	216	203	0.4836	0.4769	0.5074	1.32e-66	3vcr:B
6	1wa3:D	203	204	0.3192	0.3350	0.3333	2.07e-22	1wa3:A, 1wa3:B, 1wa3:C, 1wa3:E, 1wa3:F
7	2v82:A	205	161	0.1925	0.2000	0.2547	2.25e-11
8	7ob6:A	222	62	0.0939	0.0901	0.3226	0.039
9	3d1l:B	259	99	0.1362	0.1120	0.2929	0.24
10	2a1y:A	301	50	0.0798	0.0565	0.3400	0.28
11	7ocn:A	690	80	0.1127	0.0348	0.3000	5.0	7ocn:B, 7ocp:A, 7ocp:B, 7ocq:A, 7ocq:B, 7ocr:A, 7ocr:B, 7ocs:A, 7ocs:B, 7ocs:C, 7ocs:D, 7oct:A, 7oct:B, 7ocu:A, 7ocu:B
12	1btm:A	251	47	0.0798	0.0677	0.3617	5.0	1btm:B, 2btm:A, 2btm:B
13	3nx3:A	388	34	0.0704	0.0387	0.4412	7.2
14	4p5x:A	267	53	0.0892	0.0712	0.3585	9.9

[Back]