BioLiP

>protein
MKMNVESFNLDHTKVKAPYVRIADRKKGVNGDLIVKYDVRFKQPNRDHMDMPSLHSLEHLVAEIIRNHANYVVDWSPMGC
QTGFYLTVLNHDNYTEILEVLEKTMQDVLKAKEVPASNEKQCGWAANHTLEGAQNLARAFLDKRAEWSEVGV

The query sequence (length=152) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1j6x:B	152	152	1.0000	1.0000	1.0000	9.49e-115	1j6x:A
2	1ie0:A	156	149	0.4671	0.4551	0.4765	2.06e-42	2fqo:A, 2fqt:A, 1j98:A, 1jqw:A, 1jvi:A, 1ycl:A
3	1vh2:A	152	147	0.4211	0.4211	0.4354	1.28e-39	1inn:A, 1inn:B, 1j6v:A, 1vgx:A, 1vgx:B, 1vje:A, 1vje:B
4	4xch:A	149	137	0.3158	0.3221	0.3504	1.89e-32	4xch:B, 4xch:C, 4xch:D
5	5e68:B	172	146	0.3618	0.3198	0.3767	5.76e-32	5e68:A, 5v2w:A, 5v2w:B
6	1j6w:A	161	141	0.3684	0.3478	0.3972	9.40e-32	1j6w:B, 1joe:A, 1joe:B, 1joe:C, 1joe:D
7	8sw0:A	864	49	0.1184	0.0208	0.3673	0.16	8sw1:A
8	6ncf:B	676	48	0.1053	0.0237	0.3333	0.41	6ncf:A, 6ncf:C, 6ncf:D, 3o8y:A, 3o8y:B, 7ttk:A, 7ttk:B, 7ttl:A, 7ttl:D, 3v92:B, 3v92:A, 3v98:A, 3v98:B
9	7ttj:A	643	48	0.1053	0.0249	0.3333	0.45	7ttl:B, 3v99:A
10	7ttl:C	617	48	0.1053	0.0259	0.3333	0.47	6n2w:A, 6n2w:B
11	3v99:B	639	48	0.1053	0.0250	0.3333	0.47
12	7ttj:B	590	48	0.1053	0.0271	0.3333	0.51
13	6ei9:A	306	135	0.1776	0.0882	0.2000	2.6	6ei9:B
14	5tka:A	167	49	0.1118	0.1018	0.3469	9.7

[Back]