BioLiP

>protein
MKLYTKTGDKGTTSVIGGRVDKDDIRVEAYGTIDEANSHIGYAMTKLQGGAFIDIYNELENIQHELFDCGGDLAIVEQKI
PYKVTIVMVESLERKIDLYIEEAPPLERFILPGGSEAAATIHIARTVVRRAERSIVSLQKEVKINEVVLKYVNRLSDYLF
AIARVINARLQVKDVEYNRSAV

The query sequence (length=182) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3ke5:A	182	182	1.0000	1.0000	1.0000	1.47e-132	3ke5:C, 3ke5:B
2	3ci1:A	188	185	0.4725	0.4574	0.4649	1.87e-48	3ci3:A, 3ci4:A, 3gah:A, 3gai:A, 3gaj:A, 2nt8:A, 2r6t:A, 2r6t:B, 2r6x:A, 2r6x:B
3	2zhz:B	174	178	0.4341	0.4540	0.4438	4.01e-42	2zhz:A, 2zhz:C
4	7rut:E	187	167	0.3901	0.3797	0.4251	2.52e-33	6d5k:A, 6d5k:C, 6d5k:B, 6d5x:A, 6d5x:C, 6d5x:B, 2idx:A, 2idx:C, 2idx:B, 7rut:D, 7rut:C, 7rut:F, 7rut:B, 7rut:A, 7ruu:A, 7ruu:C, 7ruu:B, 7ruu:D, 7ruv:A, 7ruv:D, 7ruv:B, 7ruv:C
5	8d32:A	186	174	0.4121	0.4032	0.4310	2.99e-29	6wgs:A, 6wgv:A, 6wh5:A, 6wh5:B, 6wh5:C
6	6c8r:A	358	79	0.1319	0.0670	0.3038	0.73	6c8r:B, 6c8s:A, 6c8s:B
7	2zze:A	744	138	0.2033	0.0497	0.2681	1.7	2zze:B, 2zzf:A, 2zzg:A, 2zzg:B
8	6yxs:A	359	62	0.0934	0.0474	0.2742	3.0	3fi8:A, 6yxt:A
9	5go9:A	3423	47	0.0659	0.0035	0.2553	5.4	5go9:B, 5go9:C, 5go9:D, 5goa:A, 5goa:B, 5goa:C, 5goa:D
10	6jgz:B	3485	47	0.0659	0.0034	0.2553	5.4	6jg3:A, 6jg3:B, 6jg3:C, 6jg3:D, 6jgz:D, 6jgz:F, 6jgz:H, 6jh6:B, 6jh6:D, 6jh6:F, 6jh6:H, 6jhn:A, 6jhn:C, 6jhn:E, 6jhn:G, 6ji0:A, 6ji0:C, 6ji0:E, 6ji0:G, 6jrr:A, 6jrr:C, 6jrr:E, 6jrr:G
11	3mds:A	203	19	0.0659	0.0591	0.6316	6.8	3mds:B, 1mng:A, 1mng:B

[Back]