MKLTPELTPFVLFTGFEPVQVQQYIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQK
FIDEQNYILRDAEAEVLFSFSLEESLKRAHVSPLFKAKYFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQN
SSLSEIILISCENDLHLCREYFARGIDVHNAEFVLTGVLTQTLDYESYKFN
The query sequence (length=211) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3sqd:A | 211 | 211 | 1.0000 | 1.0000 | 1.0000 | 3.03e-158 | 3sqd:B |
2 | 3k05:B | 200 | 201 | 0.3033 | 0.3200 | 0.3184 | 9.30e-30 | 2azm:A, 2azm:B, 3k05:A |
3 | 3l41:A | 214 | 204 | 0.2701 | 0.2664 | 0.2794 | 1.85e-22 | |
4 | 7p0l:A | 195 | 185 | 0.2322 | 0.2513 | 0.2649 | 3.03e-12 | 7p0l:B |
5 | 8ir2:B | 198 | 79 | 0.1090 | 0.1162 | 0.2911 | 4.47e-04 | 8ir2:A, 8ir4:A, 8ir4:B |
6 | 3al3:A | 218 | 78 | 0.0948 | 0.0917 | 0.2564 | 0.008 | 7cmz:A |
7 | 2vxc:A | 223 | 127 | 0.1422 | 0.1345 | 0.2362 | 0.087 | |
8 | 6hm5:A | 251 | 55 | 0.0853 | 0.0717 | 0.3273 | 1.0 | |
9 | 6rml:B | 278 | 61 | 0.0900 | 0.0683 | 0.3115 | 1.2 | |
10 | 7lsy:Y | 855 | 77 | 0.0853 | 0.0211 | 0.2338 | 3.3 | 6bkg:A, 4htp:A, 4htp:B, 3w1b:A, 3w1g:A, 3w5o:A, 3w5o:B |
11 | 8dku:A | 395 | 58 | 0.0948 | 0.0506 | 0.3448 | 3.7 | 8dky:A, 8dky:B, 8dn8:A, 8dn8:C, 8dnc:A, 8dne:A, 8dne:C, 8dou:A, 8dou:C, 7k2t:A, 7k2t:C, 6m96:A |
12 | 6iah:A | 240 | 68 | 0.0900 | 0.0792 | 0.2794 | 3.7 | |
13 | 4a2r:A | 247 | 51 | 0.0711 | 0.0607 | 0.2941 | 6.7 | 5an7:A, 4pa8:A, 8xyn:A, 8xyn:B |
14 | 8esq:D | 427 | 115 | 0.1232 | 0.0609 | 0.2261 | 8.5 | 8esr:D, 8eth:D, 8eup:D, 8euy:D, 8ev3:D |