MKLSGGVEWALHCCVVLTAASRPVPAARLAELADVSPSYLAKQMQALSRAGLVRSVQGKTGGYVLTRPAVEITLLDVVQA
VDGPDPAFVCTEIRQRGPLATPPEKCTKACPIARAMGAAEAAWRASLAATTIADLVATVDDESGPDALPGVGAWLIEGLG
HHH
The query sequence (length=163) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6hsd:A | 166 | 163 | 0.9939 | 0.9759 | 0.9939 | 4.94e-115 | 6hsd:C, 6hsd:B, 6hsd:D, 6hse:A, 6hse:C, 6hse:B, 6hse:D, 6hsm:A, 6hsm:D, 6hsm:B, 6hsm:C, 6hsm:E, 6hsm:G, 6hsm:F, 6hsm:H, 6y42:A, 6y42:B, 6y45:A, 6y45:C, 6y45:B, 6y45:D |
2 | 4chu:B | 127 | 68 | 0.1718 | 0.2205 | 0.4118 | 4.98e-09 | |
3 | 4hf1:A | 129 | 84 | 0.1902 | 0.2403 | 0.3690 | 7.21e-09 | 4chu:A, 4hf1:B, 4hf2:A, 4hf2:B |
4 | 4cic:A | 138 | 61 | 0.1411 | 0.1667 | 0.3770 | 2.37e-07 | 4cic:B |
5 | 7b0c:A | 144 | 140 | 0.2209 | 0.2500 | 0.2571 | 3.13e-05 | 7b0c:B, 5n07:A |
6 | 8irk:A | 379 | 80 | 0.1411 | 0.0607 | 0.2875 | 1.1 | 8irk:B, 8irk:C, 8irk:D, 8iry:A, 8iry:B, 8iry:C, 8iry:D, 8irz:A, 8irz:B, 8is0:A, 8is0:B |
7 | 8jg2:A | 393 | 88 | 0.1411 | 0.0585 | 0.2614 | 9.1 | 8jg2:B |