MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHLHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEK
VYRIRTGEED
The query sequence (length=90) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1v3s:A | 97 | 95 | 1.0000 | 0.9278 | 0.9474 | 6.65e-57 | 1v3s:B, 1v3s:C, 1v9o:A, 1v9o:B, 1v9o:C |
2 | 1ul3:B | 94 | 90 | 0.5222 | 0.5000 | 0.5222 | 1.70e-25 | 1ul3:C |
3 | 3lf0:A | 99 | 91 | 0.4778 | 0.4343 | 0.4725 | 8.20e-24 | |
4 | 3ta0:C | 99 | 94 | 0.5111 | 0.4646 | 0.4894 | 1.11e-23 | 3ta0:A, 3ta0:B, 3ta0:D, 3ta0:E, 3ta0:F |
5 | 4c3k:D | 101 | 94 | 0.5222 | 0.4653 | 0.5000 | 6.25e-23 | 4c3k:A, 4c3k:E, 8wm7:F, 2xzw:E |
6 | 4cnz:A | 100 | 96 | 0.5111 | 0.4600 | 0.4792 | 7.91e-23 | 4cny:A, 4cnz:B, 4cnz:D, 4co4:A, 4co4:C, 4co4:B, 3o5t:B, 5ovo:B |
7 | 8wm7:G | 94 | 94 | 0.5222 | 0.5000 | 0.5000 | 8.28e-23 | |
8 | 5l9n:A | 92 | 91 | 0.4778 | 0.4674 | 0.4725 | 4.46e-22 | |
9 | 2eg2:A | 95 | 89 | 0.5000 | 0.4737 | 0.5056 | 1.56e-21 | |
10 | 3lf0:B | 112 | 105 | 0.4778 | 0.3839 | 0.4095 | 2.47e-21 | 3lf0:C |
11 | 2o66:B | 108 | 85 | 0.4667 | 0.3889 | 0.4941 | 3.60e-21 | 2o66:A, 2o66:C, 2o67:A, 2o67:B, 2o67:C |
12 | 3ta1:D | 115 | 108 | 0.5111 | 0.4000 | 0.4259 | 4.98e-21 | 3ta1:A, 3ta1:C, 3ta1:B, 3ta1:E, 3ta1:F, 3ta2:A, 3ta2:B, 3ta2:C |
13 | 6yc7:F | 94 | 88 | 0.4222 | 0.4043 | 0.4318 | 5.32e-21 | |
14 | 4cnz:E | 112 | 108 | 0.5111 | 0.4107 | 0.4259 | 6.67e-21 | 4cnz:C, 4cnz:F, 4co0:A, 4co0:B, 4co1:A, 4co1:B, 4co2:A, 4co2:B, 4co3:A, 4co3:B, 3mhy:A, 3mhy:C, 3mhy:B |
15 | 3n5b:A | 112 | 108 | 0.5222 | 0.4196 | 0.4352 | 2.14e-20 | 8wm7:E |
16 | 2j9d:B | 103 | 94 | 0.5222 | 0.4563 | 0.5000 | 3.08e-20 | 2j9d:H, 2j9d:K |
17 | 2xbp:A | 113 | 108 | 0.5222 | 0.4159 | 0.4352 | 8.39e-20 | 4aff:A, 4c3k:C, 4c3k:F, 2xul:A, 2xul:B, 2xul:C, 2xul:D, 2xul:E, 2xul:F, 2xzw:A, 2xzw:B, 2xzw:C, 2xzw:D, 2xzw:F, 2xzw:G, 2xzw:H, 2xzw:I |
18 | 2gnk:A | 95 | 91 | 0.4111 | 0.3895 | 0.4066 | 3.70e-19 | |
19 | 7p4v:A | 113 | 106 | 0.4667 | 0.3717 | 0.3962 | 1.57e-18 | |
20 | 2rd5:D | 126 | 102 | 0.4667 | 0.3333 | 0.4118 | 3.17e-18 | 2rd5:C |
21 | 6yc7:A | 105 | 99 | 0.4222 | 0.3619 | 0.3838 | 8.99e-18 | 6yc7:B, 6yc7:E, 6yc7:C |
22 | 2j9e:B | 119 | 107 | 0.5222 | 0.3950 | 0.4393 | 1.18e-17 | 2j9c:A, 2j9c:C, 2j9c:B, 2j9d:C, 2j9d:E, 2j9d:F, 2j9d:I, 2j9d:J, 2j9d:L, 2j9e:A, 2j9e:C, 7p52:A |
23 | 4ozl:A | 104 | 91 | 0.4556 | 0.3942 | 0.4505 | 1.05e-16 | 4ozn:B |
24 | 2ns1:B | 113 | 108 | 0.4111 | 0.3274 | 0.3426 | 1.31e-16 | 2nuu:G, 2nuu:H, 2nuu:I, 2nuu:J, 2nuu:K, 2nuu:L |
25 | 7p50:A | 121 | 106 | 0.4333 | 0.3223 | 0.3679 | 5.99e-15 | 7p50:B, 7p50:C |
26 | 3ncr:C | 116 | 106 | 0.4889 | 0.3793 | 0.4151 | 6.77e-15 | 3ncq:A, 3ncq:B, 3ncq:C, 3ncr:A, 3ncr:B |
27 | 4ozn:A | 116 | 103 | 0.4556 | 0.3534 | 0.3981 | 1.07e-14 | 4ozj:A, 4ozn:C |
28 | 4usj:C | 142 | 104 | 0.4556 | 0.2887 | 0.3942 | 2.53e-12 | 4usi:A, 4usi:C, 4usi:B, 4usj:D |
29 | 7o4x:A | 103 | 94 | 0.4000 | 0.3495 | 0.3830 | 1.22e-10 | |
30 | 4rx6:B | 115 | 101 | 0.3444 | 0.2696 | 0.3069 | 5.36e-08 | 4r25:A, 4rx6:A, 4rx6:D |
31 | 4wk1:A | 92 | 85 | 0.2556 | 0.2500 | 0.2706 | 3.61e-04 | |
32 | 4d3h:B | 104 | 96 | 0.2556 | 0.2212 | 0.2396 | 0.074 | 4d3h:A, 4d3h:C |
33 | 4rle:A | 116 | 109 | 0.3000 | 0.2328 | 0.2477 | 0.23 | |
34 | 1sb3:C | 161 | 33 | 0.1333 | 0.0745 | 0.3636 | 0.71 | 1rm6:C, 1rm6:F, 1sb3:F |
35 | 8tyx:B | 162 | 63 | 0.1889 | 0.1049 | 0.2698 | 1.4 | 8tyy:B |
36 | 3oib:A | 381 | 86 | 0.2889 | 0.0682 | 0.3023 | 1.7 | 3oib:B, 3p4t:A, 3p4t:B |
37 | 4rww:A | 113 | 109 | 0.2778 | 0.2212 | 0.2294 | 1.9 | 4rww:B, 4rww:C |
38 | 8c6j:V | 934 | 42 | 0.1667 | 0.0161 | 0.3571 | 2.2 | 6hys:A, 6hys:B, 6hys:C, 6hys:D, 6hyt:A, 6hyt:B, 6hyt:C, 6hyt:D, 6hyu:A |
39 | 6hyu:C | 585 | 40 | 0.1778 | 0.0274 | 0.4000 | 2.8 | |
40 | 7kua:A | 149 | 24 | 0.1222 | 0.0738 | 0.4583 | 2.9 | |
41 | 2qpx:A | 376 | 59 | 0.2111 | 0.0505 | 0.3220 | 3.7 | |
42 | 3w15:A | 336 | 27 | 0.1111 | 0.0298 | 0.3704 | 4.7 | |
43 | 4xz6:A | 291 | 41 | 0.1444 | 0.0447 | 0.3171 | 8.7 | 4xz6:B |