BioLiP

>protein
MKKYRVQPDGRFELKRFDPDDTSAFEGGKQAALEALAVLNRRLEKLQELLYAEGQHKVLVVLQAMDAGGKDGTIRVVFDG
VNPSGVRVASFGVPTEQELARDYLWRVHQQVPRKGELVIFNRSHYEDVLVVRVKNLVPQQVWQKRYRHIREFERMLADEG
TTILKFFLHISKDEQRQRLQERLDNPEKRWKFRMGDLEDRRLWDRYQEAYEAAIRETSTEYAPWYVIPANKNWYRNWLVS
HILVETLEGLAMQYPQPIVIE

The query sequence (length=261) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5o6m:D	264	264	0.9962	0.9848	0.9848	0.0	5lc9:B, 5lc9:C, 5lc9:D, 5lcd:A, 5lcd:B, 5lcd:C, 5lcd:D, 5ld1:A, 5ld1:D, 5ld1:B, 5ld1:C, 5ldb:A, 5ldb:B, 5ldb:C, 5ldb:D, 5maq:A, 5maq:B, 5maq:C, 5maq:D, 5o6k:A, 5o6k:B, 5o6k:C, 5o6k:D, 5o6m:A, 5o6m:B, 5o6m:C
2	6aqe:B	266	255	0.4521	0.4436	0.4627	5.35e-83	6aqe:A, 7nmj:A, 7nmj:B, 7nmj:C, 7nmj:D, 7plj:A, 7plj:B, 7plj:C, 7plj:D
3	6anh:A	300	268	0.4521	0.3933	0.4403	1.03e-75	6an9:A, 6ang:A, 6aqn:A, 6au0:A, 6b18:A
4	5llf:D	266	178	0.2414	0.2368	0.3539	1.55e-32	5ll0:A, 5ll0:B, 5ll0:C, 5ll0:D, 5llb:A, 5llb:B, 5llb:C, 5llb:D, 5llf:A, 5llf:B, 5llf:C
5	6dzg:A	288	213	0.2644	0.2396	0.3239	1.60e-29	6dzg:B, 6dzg:C, 6dzg:D
6	1xs5:A	240	51	0.0575	0.0625	0.2941	0.95
7	3nua:B	237	36	0.0613	0.0675	0.4444	0.97	3nua:A
8	3gvp:A	433	105	0.1034	0.0624	0.2571	2.5	3gvp:B, 3gvp:C, 3gvp:D, 3mtg:A, 3mtg:B
9	7ef9:A	414	104	0.1034	0.0652	0.2596	5.0	7ef8:A
10	6jdd:A	176	50	0.0575	0.0852	0.3000	5.5
11	1war:A	310	41	0.0498	0.0419	0.3171	5.7	2bq8:X
12	8ag6:B	975	24	0.0498	0.0133	0.5417	6.9	2o8b:B, 2o8c:B, 2o8d:B, 2o8e:B, 2o8f:B

[Back]