MKKIPQISDAELEVMKVIWKHSSINTNEVIKELSKTSTWSPKTIQTMLLRLIKKGALNHHKEGRVFVYTPNIDESDYIEV
KS
The query sequence (length=82) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2p7c:B | 82 | 82 | 1.0000 | 1.0000 | 1.0000 | 4.96e-56 | |
2 | 1sax:A | 120 | 74 | 0.3780 | 0.2583 | 0.4189 | 3.37e-16 | 2d45:A, 2d45:B, 2d45:C, 2d45:D, 1sax:B |
3 | 1xsd:A | 125 | 71 | 0.3415 | 0.2240 | 0.3944 | 1.39e-12 | |
4 | 2v9k:A | 467 | 38 | 0.1829 | 0.0321 | 0.3947 | 0.40 | |
5 | 6br1:F | 332 | 49 | 0.1829 | 0.0452 | 0.3061 | 1.7 | 8ahm:F, 8b7b:F, 8bdf:F, 8bdg:F, 6brf:F, 6bry:F, 6bs2:F, 8clb:F, 8clc:F, 8clf:F, 8clh:F, 6d88:F, 8diq:F, 7e4q:F, 7e4y:F, 6gj4:F, 8huh:F, 6hx8:F, 5iyz:F, 5jcb:F, 5lyj:F, 7lz7:F, 5m7e:F, 5m8g:F, 5mf4:F, 4o2a:F, 4o2b:F, 6o5m:F, 6o61:F, 7ogn:F, 5osk:F, 6qqn:F, 6qtn:F, 6s9e:F, 5sb6:F, 6ses:F, 6x1c:F, 6x1e:F, 6x1f:F, 5xaf:F, 5xag:F, 5z4p:F |
6 | 7dwx:A | 605 | 45 | 0.2195 | 0.0298 | 0.4000 | 3.2 | 7dwx:C, 8i92:B, 8i92:D, 8i93:B, 8i93:D, 6m17:A, 6m17:C, 8wby:A, 8wby:D, 8wbz:A, 8wbz:D |
7 | 8he6:B | 120 | 20 | 0.1341 | 0.0917 | 0.5500 | 8.9 |