MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFDFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVA
RVIRIRTGEEDD
The query sequence (length=92) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5l9n:A | 92 | 92 | 1.0000 | 1.0000 | 1.0000 | 1.18e-58 | |
2 | 2eg2:A | 95 | 89 | 0.7065 | 0.6842 | 0.7303 | 5.87e-40 | |
3 | 2gnk:A | 95 | 92 | 0.6413 | 0.6211 | 0.6413 | 2.26e-37 | |
4 | 4cnz:A | 100 | 96 | 0.6196 | 0.5700 | 0.5938 | 4.57e-35 | 4cny:A, 4cnz:B, 4cnz:D, 4co4:A, 4co4:C, 4co4:B, 3o5t:B, 5ovo:B |
5 | 2ns1:B | 113 | 109 | 0.6413 | 0.5221 | 0.5413 | 1.03e-33 | 2nuu:G, 2nuu:H, 2nuu:I, 2nuu:J, 2nuu:K, 2nuu:L |
6 | 8wm7:G | 94 | 94 | 0.6304 | 0.6170 | 0.6170 | 2.14e-33 | |
7 | 4cnz:E | 112 | 108 | 0.6196 | 0.5089 | 0.5278 | 2.52e-33 | 4cnz:C, 4cnz:F, 4co0:A, 4co0:B, 4co1:A, 4co1:B, 4co2:A, 4co2:B, 4co3:A, 4co3:B, 3mhy:A, 3mhy:C, 3mhy:B |
8 | 4c3k:D | 101 | 94 | 0.6304 | 0.5743 | 0.6170 | 1.63e-32 | 4c3k:A, 4c3k:E, 8wm7:F, 2xzw:E |
9 | 3lf0:A | 99 | 92 | 0.5761 | 0.5354 | 0.5761 | 3.25e-32 | |
10 | 1ul3:B | 94 | 91 | 0.6087 | 0.5957 | 0.6154 | 2.14e-31 | 1ul3:C |
11 | 3n5b:A | 112 | 108 | 0.6304 | 0.5179 | 0.5370 | 2.81e-31 | 8wm7:E |
12 | 3lf0:B | 112 | 105 | 0.5761 | 0.4732 | 0.5048 | 4.78e-30 | 3lf0:C |
13 | 2xbp:A | 113 | 108 | 0.6196 | 0.5044 | 0.5278 | 1.83e-29 | 4aff:A, 4c3k:C, 4c3k:F, 2xul:A, 2xul:B, 2xul:C, 2xul:D, 2xul:E, 2xul:F, 2xzw:A, 2xzw:B, 2xzw:C, 2xzw:D, 2xzw:F, 2xzw:G, 2xzw:H, 2xzw:I |
14 | 6yc7:F | 94 | 92 | 0.4783 | 0.4681 | 0.4783 | 9.95e-29 | |
15 | 6yc7:A | 105 | 102 | 0.4891 | 0.4286 | 0.4412 | 3.84e-28 | 6yc7:B, 6yc7:E, 6yc7:C |
16 | 2j9d:B | 103 | 94 | 0.5652 | 0.5049 | 0.5532 | 5.09e-28 | 2j9d:H, 2j9d:K |
17 | 2o66:B | 108 | 91 | 0.5217 | 0.4444 | 0.5275 | 1.52e-27 | 2o66:A, 2o66:C, 2o67:A, 2o67:B, 2o67:C |
18 | 3ta0:C | 99 | 94 | 0.5435 | 0.5051 | 0.5319 | 1.12e-26 | 3ta0:A, 3ta0:B, 3ta0:D, 3ta0:E, 3ta0:F |
19 | 2j9e:B | 119 | 107 | 0.5652 | 0.4370 | 0.4860 | 6.15e-26 | 2j9c:A, 2j9c:C, 2j9c:B, 2j9d:C, 2j9d:E, 2j9d:F, 2j9d:I, 2j9d:J, 2j9d:L, 2j9e:A, 2j9e:C, 7p52:A |
20 | 7p4v:A | 113 | 109 | 0.5326 | 0.4336 | 0.4495 | 4.84e-25 | |
21 | 3ta1:D | 115 | 108 | 0.5435 | 0.4348 | 0.4630 | 1.77e-24 | 3ta1:A, 3ta1:C, 3ta1:B, 3ta1:E, 3ta1:F, 3ta2:A, 3ta2:B, 3ta2:C |
22 | 2rd5:D | 126 | 108 | 0.5109 | 0.3730 | 0.4352 | 8.18e-24 | 2rd5:C |
23 | 3ncr:C | 116 | 109 | 0.5543 | 0.4397 | 0.4679 | 1.54e-22 | 3ncq:A, 3ncq:B, 3ncq:C, 3ncr:A, 3ncr:B |
24 | 7p50:A | 121 | 106 | 0.5000 | 0.3802 | 0.4340 | 2.24e-22 | 7p50:B, 7p50:C |
25 | 1v3s:A | 97 | 96 | 0.4674 | 0.4433 | 0.4479 | 3.63e-22 | 1v3s:B, 1v3s:C, 1v9o:A, 1v9o:B, 1v9o:C |
26 | 4ozl:A | 104 | 91 | 0.4783 | 0.4231 | 0.4835 | 2.21e-16 | 4ozn:B |
27 | 7o4x:A | 103 | 97 | 0.3696 | 0.3301 | 0.3505 | 5.04e-16 | |
28 | 4usj:C | 142 | 105 | 0.4783 | 0.3099 | 0.4190 | 2.10e-15 | 4usi:A, 4usi:C, 4usi:B, 4usj:D |
29 | 4rx6:B | 115 | 107 | 0.3804 | 0.3043 | 0.3271 | 6.51e-15 | 4r25:A, 4rx6:A, 4rx6:D |
30 | 4ozn:A | 116 | 103 | 0.4783 | 0.3793 | 0.4272 | 2.61e-14 | 4ozj:A, 4ozn:C |
31 | 3t0q:A | 304 | 28 | 0.1304 | 0.0395 | 0.4286 | 5.4 |