MKKATCLTDDQRWQSVLARDPNADGEFVFAVRTTGIFCRPSCRARHALRENVSFYANASEALAAGFRPCKRCQPDKANPR
QHRLDKITHACRLLEQETPVTLEALADQVAMSPFHLHRLFKATTGMTPKAWQQAWRARR
The query sequence (length=139) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1wpk:A | 146 | 139 | 0.9784 | 0.9315 | 0.9784 | 1.16e-100 | 1adn:A, 1eyf:A, 1u8b:A, 1zgw:A |
2 | 1xs9:A | 129 | 29 | 0.0863 | 0.0930 | 0.4138 | 0.032 | 1bl0:A |
3 | 1d5y:A | 288 | 43 | 0.1151 | 0.0556 | 0.3721 | 0.64 | 1d5y:B, 1d5y:D, 1d5y:C, 7vwy:G, 7vwz:G, 7vwz:I |
4 | 1h54:B | 754 | 130 | 0.1942 | 0.0358 | 0.2077 | 0.99 | |
5 | 4bga:C | 322 | 37 | 0.0935 | 0.0404 | 0.3514 | 3.7 | 4bg8:A, 4bg8:B, 4bg9:A, 4bga:A, 4bga:D, 4bga:B, 4bgb:A, 4bgb:B |
6 | 2y4e:A | 384 | 81 | 0.1511 | 0.0547 | 0.2593 | 3.7 | 3o72:A, 3o72:B, 3o72:C, 3o72:D, 2y4e:B, 2y4f:A, 2y4f:B |
7 | 6idy:A | 421 | 44 | 0.1151 | 0.0380 | 0.3636 | 5.4 | 6idy:B, 6idy:C |