MKIYGIYMDRPLSQEENERFMTFISPEKREKCRRFYHKEDAHRTLLGDVLVRSVISRQYQLDKSDIRFSTQEYGKPCIPD
LPDAHFNISHSGRWVIGAFDSQPIGIDIEKTKPISLEIAKRFFSKTEYSDLLAKDKDEQTDYFYHLWSMKESFIKQEGKG
LSLPLDSFSVRLHQDGQVSIELPDSHSPCYIKTYEVDPGYKMAVCAAHPDFPEDITMVSYEELLRAAA
The query sequence (length=228) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1qr0:A | 228 | 228 | 1.0000 | 1.0000 | 1.0000 | 8.16e-173 | 4mrt:A |
2 | 2c43:A | 280 | 154 | 0.2237 | 0.1821 | 0.3312 | 3.65e-19 | 2cg5:A |
3 | 1fth:A | 117 | 64 | 0.0921 | 0.1795 | 0.3281 | 0.015 | 1fth:B, 1fth:C |
4 | 4i8p:A | 500 | 96 | 0.1009 | 0.0460 | 0.2396 | 0.76 | 4i8p:B |
5 | 1f7l:A | 118 | 85 | 0.1053 | 0.2034 | 0.2824 | 2.3 | |
6 | 8arn:A | 509 | 56 | 0.0746 | 0.0334 | 0.3036 | 7.5 | 8are:A, 8arn:B |
7 | 8tc0:B | 1091 | 47 | 0.0570 | 0.0119 | 0.2766 | 7.7 | 8tc0:A, 8tc0:C, 8tc1:C, 8tc1:A, 8tc1:B, 8tc5:C, 8tc5:A, 8tc5:B, 1zv8:A, 1zv8:C, 1zv8:E, 5zvm:A, 5zvm:B |
8 | 5u1o:B | 451 | 46 | 0.0614 | 0.0310 | 0.3043 | 7.8 | 5u1o:A, 5u1o:C, 5u1o:D |
9 | 4bqh:A | 521 | 79 | 0.0921 | 0.0403 | 0.2658 | 8.9 |