MKITSSNFATIATSENFAKLSVLPKNHREPIKGLFKSAVEQFSSARDFFKNENYSKELAEKFNKEAVNEAVEKLQKAIDL
AEKQGIQ
The query sequence (length=87) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8hnt:C | 88 | 87 | 1.0000 | 0.9886 | 1.0000 | 3.12e-58 | 8hnv:E, 8ja0:D |
2 | 3waj:A | 793 | 52 | 0.1954 | 0.0214 | 0.3269 | 0.43 | |
3 | 7e9s:A | 867 | 52 | 0.1954 | 0.0196 | 0.3269 | 0.44 | 5gmy:A, 3wak:A |
4 | 4ykn:A | 1205 | 49 | 0.1609 | 0.0116 | 0.2857 | 0.52 | 4a55:A, 8am0:A, 8exl:A, 8exo:A, 8exu:A, 8exv:A, 5fi4:A, 8gub:A, 6gvf:A, 6gvg:A, 6gvi:A, 3hhm:A, 7jiu:A, 4jps:A, 4l23:A, 4l2y:A, 7mlk:A, 7myo:A, 4ovv:A, 8ow2:A, 7pg6:A, 6pys:A, 5sx9:A, 5sxj:A, 8tdu:A, 8tdu:C, 8tgd:A, 8tgd:C, 8ts9:A, 8tsa:A, 8tsb:A, 8tsc:A, 8tsd:A, 4tv3:A, 5uk8:A, 5ukj:A, 5ul1:A, 8v8h:A, 8v8h:C, 8v8i:A, 8v8i:C, 8v8j:A, 8v8j:C, 8v8v:A, 8v8v:C, 8w9a:A, 8w9b:A, 4waf:A, 5xgh:A, 5xgi:A, 3zim:A, 4zop:A |
5 | 5hl3:A | 356 | 27 | 0.0920 | 0.0225 | 0.2963 | 1.5 | |
6 | 4mph:B | 184 | 19 | 0.1264 | 0.0598 | 0.5789 | 2.6 | 4mph:A |
7 | 2fdc:A | 505 | 42 | 0.1494 | 0.0257 | 0.3095 | 7.2 | |
8 | 6o8e:A | 592 | 42 | 0.1494 | 0.0220 | 0.3095 | 7.3 | 1d9z:A, 2fdc:B, 6o8e:B, 6o8f:A, 6o8f:B, 6o8g:A |
9 | 5swo:B | 267 | 49 | 0.1609 | 0.0524 | 0.2857 | 8.6 | 5gji:A, 2iuh:A, 2iui:A, 2iui:B, 7rns:A, 5sxk:B |