BioLiP

>protein
MKINFSLLDEPMEVNLGTVLVIEDVSVFAQLVKEFYQYDEQSNLTIFDSKIRSIRSSELLLITDILGYDINTSQVLKLLH
TDIVSQLNDKPEVRSEIDSLVSLITDIIMAECIENELDIEYDEITLLELIKALGVRIETKSCTVFEKIFEILQIFKYLVK
KRILVFVNSLSYFSKDEIYQILEYTKLSQADVLFLEPRQIEGIQQFILDKDYILMPYN

The query sequence (length=218) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6qxf:B	219	218	1.0000	0.9954	1.0000	2.13e-154	6qxf:A, 6qxf:C, 6qxf:D, 6qxf:E, 6qxf:F, 6qxf:G, 6qxf:H
2	3v7f:B	220	218	0.5734	0.5682	0.5734	1.90e-89	3toc:A, 3toc:B, 3v7f:A
3	3qhq:A	222	218	0.5596	0.5495	0.5596	1.55e-88	3qhq:B
4	3s5u:E	213	213	0.4587	0.4695	0.4695	1.03e-66	3s5u:A, 3s5u:B, 3s5u:C, 3s5u:D, 3s5u:F, 3s5u:G, 3s5u:H
5	3vog:A	362	57	0.0826	0.0497	0.3158	1.1	3voh:A, 3voi:A
6	3faw:A	775	72	0.1009	0.0284	0.3056	1.4	3fax:A
7	1gl6:B	420	54	0.0734	0.0381	0.2963	5.0	1gki:A, 1gki:B, 1gki:D, 1gki:E, 1gki:F, 1gki:G, 1gl6:A, 1gl6:D, 1gl6:E, 1gl6:F, 1gl6:G, 1gl7:A, 1gl7:B, 1gl7:D, 1gl7:E, 1gl7:F, 1gl7:G
8	2vhf:A	341	63	0.0780	0.0499	0.2698	5.3	2vhf:B
9	6ogz:A	1082	60	0.0688	0.0139	0.2500	5.4	6ogy:A, 6oj6:P, 2r7r:A, 2r7s:A, 2r7t:A, 2r7u:A, 2r7v:A, 2r7w:A, 2r7x:A, 2r7x:B
10	4onj:B	333	62	0.0826	0.0541	0.2903	7.0	4onj:A, 4onq:A, 4onq:B

[Back]