MKIIIEYDSCWRNAFLGGSNNEPVPKKGREFLGSMTSLKKEGNFKVCENTLDTVMGVLNRLIGDQRKLYQARSKMYESAY
YFEALEDKVSFIDKPQLTNEISFIRNMNGSTDQNAFTGMIKVSDPVFTSEYSQQFWGVLALDFTQLCDFIIKQSQVVGSI
ELNPLSIINRLESLNQEKALENSDDLAQVLKVLNEYFPDIEYLNNKGLITPISIYCSALYLQLARLETSFNMTTAKTKAG
GISGISKRGFTKKDFMDRYTTGPKKTIWGNPFIKKEKIKGQGEVTSMMTKASGQLEISIDVDRDKAQEIKILIENAGVSS
FYLGKKGLAYVSNIKL
The query sequence (length=336) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5o6u:F | 336 | 336 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 5o7h:F |
2 | 2rgo:B | 530 | 74 | 0.0655 | 0.0415 | 0.2973 | 0.34 | |
3 | 3h1m:A | 392 | 120 | 0.0923 | 0.0791 | 0.2583 | 2.2 | 3h1w:A, 3h1y:A, 5zvr:A, 5zvu:A, 5zvx:A |
4 | 8u4z:A | 313 | 45 | 0.0446 | 0.0479 | 0.3333 | 2.3 | |
5 | 2rgo:A | 557 | 55 | 0.0536 | 0.0323 | 0.3273 | 2.8 | 2rgh:A |
6 | 6fb3:A | 1836 | 70 | 0.0595 | 0.0109 | 0.2857 | 3.1 | 6fb3:B, 6fb3:C, 6fb3:D, 6ska:A, 6ske:A, 6ske:C |
7 | 3b9o:A | 433 | 52 | 0.0506 | 0.0393 | 0.3269 | 4.0 | 3b9o:B |
8 | 6pxu:B | 532 | 108 | 0.0804 | 0.0508 | 0.2500 | 4.2 | 6pxu:A |
9 | 2k3u:A | 91 | 47 | 0.0506 | 0.1868 | 0.3617 | 5.0 | |
10 | 3vmm:A | 471 | 74 | 0.0714 | 0.0510 | 0.3243 | 5.8 | 3wnz:A, 3wo0:A, 3wo1:A |
11 | 9c9y:A | 612 | 49 | 0.0417 | 0.0229 | 0.2857 | 6.2 | 9ca0:A, 9ca1:A |
12 | 6jrs:A | 3488 | 54 | 0.0476 | 0.0046 | 0.2963 | 7.0 | 6jrs:D, 6jrs:G, 6jrs:J |
13 | 5go9:A | 3423 | 54 | 0.0476 | 0.0047 | 0.2963 | 7.0 | 5go9:B, 5go9:C, 5go9:D, 5goa:A, 5goa:B, 5goa:C, 5goa:D |
14 | 6jgz:B | 3485 | 54 | 0.0476 | 0.0046 | 0.2963 | 7.1 | 6jg3:A, 6jg3:B, 6jg3:C, 6jg3:D, 6jgz:D, 6jgz:F, 6jgz:H, 6jh6:B, 6jh6:D, 6jh6:F, 6jh6:H, 6jhn:A, 6jhn:C, 6jhn:E, 6jhn:G, 6ji0:A, 6ji0:C, 6ji0:E, 6ji0:G, 6jrr:A, 6jrr:C, 6jrr:E, 6jrr:G |
15 | 6jiy:A | 3521 | 54 | 0.0476 | 0.0045 | 0.2963 | 7.2 | 6ji8:A, 6ji8:D, 6ji8:G, 6ji8:J, 6jii:B, 6jii:E, 6jii:H, 6jii:K, 6jiu:A, 6jiu:D, 6jiu:G, 6jiu:J, 6jiy:D, 6jiy:G, 6jiy:J, 6jv2:A, 6jv2:C, 6jv2:E, 6jv2:G |
16 | 2v2f:F | 366 | 130 | 0.0923 | 0.0847 | 0.2385 | 7.6 | |
17 | 5nw7:A | 440 | 88 | 0.0744 | 0.0568 | 0.2841 | 8.7 | 1pmi:A |