MKIAVMTDSTSYLSQDLIDKYNIQIAPLSVTFDDGKNFTESNEIAIEEFYNKMASSQTIPTTSQPAIGEWITKYEMLRDQ
GYTDIIVICLSSGISGSYQSSYQAGEMVEGVNVHAFDSKLAAMIEGCYVLRAIEMVEEGYEPQQIIDDLTNMREHTGAYL
IVDDLKNLQKSGRITGAQAWVMKPVLKFEDGKIIPEEKVRTKKRAIQTLEKKVLDIVKDFEEVTLFVINGDHFEDGQALY
KKLQDDCPSAYQVAYSEFGPVVAAHLGSGGLGLGYVGRKIRLT
The query sequence (length=283) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6alw:A | 288 | 288 | 1.0000 | 0.9826 | 0.9826 | 0.0 | 6alw:B, 6b9i:A, 6b9i:B |
2 | 3fys:A | 282 | 281 | 0.3534 | 0.3546 | 0.3559 | 1.09e-54 | |
3 | 3lup:A | 283 | 285 | 0.2933 | 0.2933 | 0.2912 | 3.45e-36 | |
4 | 2dt8:A | 280 | 282 | 0.2968 | 0.3000 | 0.2979 | 1.53e-29 | |
5 | 2g7z:A | 275 | 209 | 0.2261 | 0.2327 | 0.3062 | 2.17e-21 | 2g7z:B |
6 | 6nr1:A | 279 | 283 | 0.2615 | 0.2652 | 0.2615 | 1.15e-17 | 6nr1:B |
7 | 5v85:B | 279 | 214 | 0.1837 | 0.1864 | 0.2430 | 4.12e-13 | 5v85:A |
8 | 5uxy:A | 276 | 153 | 0.1237 | 0.1268 | 0.2288 | 3.51e-04 | |
9 | 2gjw:A | 308 | 79 | 0.0707 | 0.0649 | 0.2532 | 2.7 | 2gjw:B, 2gjw:C, 2gjw:D |
10 | 7ob9:A | 1535 | 95 | 0.0813 | 0.0150 | 0.2421 | 2.8 | 7oba:A |
11 | 4nl8:A | 549 | 67 | 0.0636 | 0.0328 | 0.2687 | 3.0 | |
12 | 3ikw:A | 373 | 53 | 0.0530 | 0.0402 | 0.2830 | 3.8 | 3ilr:A, 3imn:A, 3in9:A, 3ina:A |
13 | 5klq:A | 324 | 33 | 0.0424 | 0.0370 | 0.3636 | 5.6 | 5klp:A, 5klp:B, 5klp:C, 5klq:C, 5klq:B |