MKIAKVINNNVISVVNEQGKELVVMGRGLAFQKKSGDDVDEARIEKVFTLDNKDV
The query sequence (length=55) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1l1c:A | 55 | 55 | 1.0000 | 1.0000 | 1.0000 | 3.27e-33 | 1l1c:B |
2 | 8u0z:A | 260 | 37 | 0.1818 | 0.0385 | 0.2703 | 0.54 | 8u0z:B |
3 | 6k0g:A | 335 | 50 | 0.3273 | 0.0537 | 0.3600 | 1.8 | 6k0h:A, 6k0i:A |
4 | 3fvz:A | 329 | 46 | 0.2364 | 0.0395 | 0.2826 | 3.9 | 3fw0:A |
5 | 5vt9:B | 139 | 18 | 0.1636 | 0.0647 | 0.5000 | 4.9 | 5vt9:A |
6 | 8jfl:A | 970 | 37 | 0.2364 | 0.0134 | 0.3514 | 5.4 | 8jfl:E, 8jfl:M, 8jfl:I, 8xy7:A |
7 | 8jfk:M | 986 | 37 | 0.2364 | 0.0132 | 0.3514 | 5.4 | 8jfk:A, 8jfk:I, 8jfk:E, 8xya:A, 8xyb:A |
8 | 3t2z:A | 427 | 33 | 0.1636 | 0.0211 | 0.2727 | 7.9 | 3kpk:A, 3sx6:A, 3sxi:A, 3sy4:A, 3syi:A, 3sz0:A, 3szc:A, 3szf:A, 3szw:A, 3t0k:A, 3t14:A, 3t2k:A, 3t2y:A, 3t2z:B, 3t31:A |
9 | 4n54:A | 340 | 19 | 0.1455 | 0.0235 | 0.4211 | 9.4 | 4n54:B, 4n54:C, 4n54:D |