MKIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVDIISLKNGVYTKSFDEVDVNDYDRLIVVNSNLAILSAQKFMAK
YKSKIYYLFTDIRLPFSQSEEELLIKSPIKVISQGINLDIAKAAHKKVDNVIEFEYFPIEQYKIHMNDFQLSKPTKKTLD
VIYGGSFRSGQRESKMVEFLFDTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIGDKNYND
NFITLRVWETMASDAVMLIDEEFDTKHRIINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAKKAEWQD
AFKKAIDL
The query sequence (length=328) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2bgu:A | 328 | 328 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 1ixy:A | 351 | 351 | 1.0000 | 0.9345 | 0.9345 | 0.0 | 1c3j:A, 1ixy:B, 1j39:A, 1jg6:A, 1jg7:A, 1jiu:A, 1jiv:A, 1jix:A, 1m5r:A, 1m5r:B, 1nvk:A, 1nzd:A, 1nzf:A, 1qkj:A, 1sxp:A, 1sxp:B, 1sxq:A, 1sxq:B |
3 | 3v77:A | 224 | 61 | 0.0518 | 0.0759 | 0.2787 | 0.60 | 3v77:B, 3v77:C, 3v77:D, 3v77:E, 3v77:F |
4 | 7lt2:A | 387 | 119 | 0.0945 | 0.0801 | 0.2605 | 3.0 | |
5 | 8bh6:j | 102 | 102 | 0.0823 | 0.2647 | 0.2647 | 3.1 | 7aso:1, 7asp:a, 7bge:j, 8bh7:j, 8buu:j, 8byv:j, 8cdu:K, 8cec:R, 8ced:K, 8cee:K, 6fxc:Aj, 6fxc:Bj, 6ha1:j, 6ha8:j, 6htq:j, 3j9w:AJ, 7kwg:j, 5li0:j, 5nd8:j, 5nd9:j, 5ngm:Aj, 7nhl:k, 7nhm:k, 5njt:J, 7o5b:J, 8p2f:k, 8p2g:k, 8p2h:k, 7p48:j, 8qcq:j, 7qgu:o, 7qh4:n, 8qpp:J, 7qv1:j, 7qv2:j, 7qv3:j, 8r55:J, 6s0x:j, 6s13:j, 5t7v:S1, 5tcu:S1, 8y38:j, 8y39:j, 6yef:j |
6 | 5c4i:A | 394 | 103 | 0.0823 | 0.0685 | 0.2621 | 3.6 | 5c4i:D, 5exd:A, 5exd:D, 5exd:G, 5exd:J, 5exe:A, 5exe:D |
7 | 6h0h:A | 410 | 75 | 0.0671 | 0.0537 | 0.2933 | 3.6 | 6h0h:B |
8 | 4oe4:B | 481 | 41 | 0.0396 | 0.0270 | 0.3171 | 4.2 | 4oe4:A |
9 | 7acv:A | 307 | 48 | 0.0457 | 0.0489 | 0.3125 | 6.3 | |
10 | 6wmp:C | 1196 | 45 | 0.0457 | 0.0125 | 0.3333 | 7.2 | 6wmr:C, 6wmt:C |
11 | 4dx9:y | 93 | 48 | 0.0549 | 0.1935 | 0.3750 | 7.4 | |
12 | 4eso:B | 251 | 56 | 0.0457 | 0.0598 | 0.2679 | 7.5 | 4eso:A, 4eso:C, 4eso:D |
13 | 5zba:A | 360 | 31 | 0.0335 | 0.0306 | 0.3548 | 8.5 | |
14 | 3ahc:A | 802 | 46 | 0.0488 | 0.0200 | 0.3478 | 9.8 | 3ahd:A, 3ahe:A, 3ahf:A, 3ahg:A, 3ahh:A, 3ahi:A, 3ahj:A |