MKGMSKMPQVNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA
The query sequence (length=53) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1bdt:B | 53 | 53 | 0.9811 | 0.9811 | 0.9811 | 5.06e-33 | 1bdt:A, 1bdt:C, 1bdt:D, 1bdv:A, 1bdv:B, 1bdv:C, 1bdv:D, 1par:A, 1par:B, 1par:C, 1par:D |
2 | 3qoq:A | 50 | 38 | 0.2642 | 0.2800 | 0.3684 | 0.059 | 3qoq:B, 3qoq:C, 3qoq:D |
3 | 6ejp:D | 90 | 32 | 0.1887 | 0.1111 | 0.3125 | 2.3 | 6ejp:C |
4 | 2fld:A | 161 | 42 | 0.2642 | 0.0870 | 0.3333 | 2.8 | 3ko2:A, 3ko2:B, 3ko2:F, 3ko2:G, 1m5x:A, 1m5x:B, 3mis:A, 3mis:B |
5 | 6q7i:A | 770 | 21 | 0.1698 | 0.0117 | 0.4286 | 2.8 | 6q7j:A, 6q7j:B |
6 | 3fd2:A | 338 | 42 | 0.2642 | 0.0414 | 0.3333 | 3.2 | 2fld:B, 3mip:A, 3mip:B |
7 | 3fd2:A | 338 | 42 | 0.2642 | 0.0414 | 0.3333 | 3.2 | 2fld:B, 3mip:A, 3mip:B |
8 | 5d3m:A | 280 | 19 | 0.1887 | 0.0357 | 0.5263 | 4.2 | 8bmp:A, 8bmq:A, 8bms:A, 5d3m:E |
9 | 2p5v:G | 158 | 39 | 0.2830 | 0.0949 | 0.3846 | 5.0 | 2p5v:A, 2p5v:B, 2p5v:C, 2p5v:E, 2p5v:D, 2p5v:F, 2p5v:H, 2p6s:A, 2p6s:G, 2p6s:B, 2p6s:D, 2p6s:C, 2p6s:F, 2p6s:E, 2p6s:H, 2p6t:A, 2p6t:G, 2p6t:B, 2p6t:D, 2p6t:C, 2p6t:F, 2p6t:E, 2p6t:H |
10 | 7dsx:B | 509 | 43 | 0.2453 | 0.0255 | 0.3023 | 6.6 | 7dsv:A, 7dsv:B, 7dsw:B, 7dsw:A, 7dsx:A |
11 | 3e78:A | 365 | 22 | 0.1698 | 0.0247 | 0.4091 | 7.0 | 3e79:A, 3eki:A |
12 | 7vg5:A | 204 | 45 | 0.2642 | 0.0686 | 0.3111 | 8.6 | 7vg5:B |
13 | 1yo7:A | 120 | 62 | 0.3396 | 0.1500 | 0.2903 | 8.7 | 1yo7:B |
14 | 7mvz:A | 1641 | 29 | 0.1698 | 0.0055 | 0.3103 | 9.3 | 7tbi:F1, 7tbi:F2, 7tbj:F1, 7tbj:F2, 7tbk:F1, 7tbk:F2, 7tbl:F1, 7tbl:F2, 7tbm:F1, 7tbm:F2 |