BioLiP

>protein
MKFETINQESIAKLMEIFYEKVRKDKDLGPIFNNAIGTSDEEWKEHKAKIGNFWAGMLLGEGDYNGQPLKKHLDLPPFPQ
EFFEIWLKLFEESLNIVYNEEMKNVILQRAQMIASHFQNMLYKYGGH

The query sequence (length=127) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2ig3:A	127	127	1.0000	1.0000	1.0000	4.59e-92	2ig3:B
2	1ux8:A	118	119	0.2441	0.2627	0.2605	1.37e-06
3	2bkm:A	128	121	0.2520	0.2500	0.2645	8.61e-04	2bkm:B
4	5v3u:A	131	132	0.2598	0.2519	0.2500	0.013	5v3t:A, 5v3t:B, 5v3u:B, 5v3v:A, 5v3v:B
5	4xdi:A	127	63	0.1339	0.1339	0.2698	0.017	6cii:A, 4xdi:B
6	2xyk:B	130	124	0.2362	0.2308	0.2419	0.12	2xyk:A
7	1s56:B	135	65	0.1575	0.1481	0.3077	0.33	5ab8:A, 2gkm:A, 2gkm:B, 2gkn:A, 2gkn:B, 2gl3:A, 2gl3:B, 2gln:A, 2gln:B, 1idr:A, 1idr:B, 1rte:A, 1rte:B, 1s56:A, 1s61:A, 1s61:B
8	7ney:A	497	51	0.1417	0.0362	0.3529	1.2	7ney:B, 7nf0:A, 7nf0:B, 7nf1:A, 7nf1:B, 7nf2:A, 7nf2:B
9	4ihc:B	395	46	0.1339	0.0430	0.3696	2.3	4ihc:C, 4ihc:D, 4ihc:E, 4ihc:F, 4ihc:H
10	3jb9:c	300	27	0.0945	0.0400	0.4444	2.6
11	3twb:C	417	46	0.1339	0.0408	0.3696	2.9	4ihc:A, 4ihc:G, 3twa:A, 3twa:B, 3twa:C, 3twa:D, 3twa:E, 3twb:A, 3twb:B, 3twb:D, 3twb:E
12	7mop:A	2445	25	0.0866	0.0045	0.4400	4.1	6fyh:A, 6pfl:A, 6pfl:B, 8r7o:A, 8r7o:C, 8rd0:C, 8rd0:D, 8rd1:A, 8rd1:C, 8rd1:D, 8rd7:D, 6xz1:A
13	4bih:A	172	26	0.0866	0.0640	0.4231	4.4
14	7qep:MD	170	28	0.0945	0.0706	0.4286	4.9
15	4gir:B	411	32	0.1102	0.0341	0.4375	5.9	4ggh:A, 4ggh:B, 4ggh:C, 4ggh:D, 4gir:A, 4gir:C, 4gir:D, 4gis:A, 4gis:B
16	4ag5:A	374	77	0.1732	0.0588	0.2857	7.3	4ag5:B, 4ag5:C
17	8fru:G	197	44	0.1181	0.0761	0.3409	9.9	8br8:LI, 8brm:LI, 8bsi:LI, 8bsj:LI, 8btd:LI, 8btr:LI, 7pwg:G, 7pwo:G2

[Back]