BioLiP

>protein
MKELVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFLPGTRNRRVTITGSPAATQAAQYLISQRVTYEQGVR
ASNPQKV

The query sequence (length=87) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1ec6:A	87	87	1.0000	1.0000	1.0000	2.25e-58	1ec6:B
2	2p2r:A	73	71	0.3333	0.3973	0.4085	2.52e-13
3	2anr:A	155	70	0.2989	0.1677	0.3714	2.19e-11	2ann:A
4	2anr:A	155	69	0.3103	0.1742	0.3913	2.51e-07	2ann:A
5	1zzi:A	82	68	0.2989	0.3171	0.3824	4.02e-10	7cre:A, 1j5k:A, 1zzi:B, 1zzj:A, 1zzj:B
6	8coo:A	191	65	0.2529	0.1152	0.3385	2.85e-04	2n8l:A, 2n8m:A
7	8coo:A	191	35	0.1724	0.0785	0.4286	0.008	2n8l:A, 2n8m:A
8	1j4w:A	145	65	0.2299	0.1379	0.3077	6.14e-04	6y2c:A
9	1j4w:A	145	70	0.2299	0.1379	0.2857	0.001	6y2c:A
10	6y2c:B	84	71	0.2414	0.2500	0.2958	7.06e-04
11	7yey:A	162	59	0.2299	0.1235	0.3390	0.002	7vkl:A
12	7yey:A	162	76	0.2414	0.1296	0.2763	0.020	7vkl:A
13	3vke:A	76	69	0.2529	0.2895	0.3188	0.031	2axy:B, 2axy:D, 2pqu:C, 2pqu:B, 2py9:B, 2py9:C, 3vke:B, 3vke:C, 3vke:D, 1ztg:A, 1ztg:D, 1ztg:B, 1ztg:C
14	4b8t:A	106	67	0.1954	0.1604	0.2537	0.032
15	2axy:A	72	27	0.1494	0.1806	0.4815	0.14	2axy:C, 2pqu:A, 2py9:A
16	4aim:A	698	36	0.1379	0.0172	0.3333	0.45	4aid:A, 4aid:B, 4aid:C, 4am3:A, 4am3:C, 4am3:B
17	4wal:A	127	31	0.1494	0.1024	0.4194	0.51	4wan:A, 4wan:C, 4wan:E, 4wan:G
18	4jvy:A	191	31	0.1494	0.0681	0.4194	1.4	4jvy:B, 2mjh:A
19	4cw5:B	438	19	0.1149	0.0228	0.5263	2.2	4cw5:A
20	6e9b:D	368	67	0.2069	0.0489	0.2687	5.7
21	1k1g:A	122	44	0.1839	0.1311	0.3636	6.9
22	4jvh:A	176	31	0.1494	0.0739	0.4194	8.6
23	3aev:B	177	65	0.1954	0.0960	0.2615	9.9

[Back]