MKEKSIEDIVFEKFQPYINWSIDKLCEHFSINKGEKGLNYRIASAILNLKGKTTKSKPFPEVEEFEKSSIVVKTVHFNKK
NVNKESMSFGAFKFEELANEEWEDSEGYPSAQWRNFLLETRFLFFVVKEDEDGVDIFKGIKFFSMPEEDINGPVKRMWDD
TVKKLKEGVTLEAVPDKSTKDGWRIKNNFVDKSDDLICHVRPHTNNRDYRGGSNADKLPKKINWINRPDSDDYSDEWMTK
QSFWINNDYIKKQVEDLL
The query sequence (length=258) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4pxg:A | 466 | 258 | 0.9961 | 0.5515 | 0.9961 | 0.0 | 2reu:A, 7xm0:A, 7xm0:B, 7xm0:C |
2 | 4nap:D | 310 | 138 | 0.1395 | 0.1161 | 0.2609 | 0.42 | 4nap:A, 4nap:B, 4nap:C, 4pgn:A, 4pgn:B, 4pgn:C, 4pgn:D, 4pgp:A, 4pgp:B, 4pgp:C, 4pgp:D |
3 | 4r78:A | 287 | 130 | 0.1395 | 0.1254 | 0.2769 | 4.3 | 4r7b:A, 4r7b:B |
4 | 3a27:A | 219 | 35 | 0.0465 | 0.0548 | 0.3429 | 4.4 |