MKEIKGILESITGFSIPLDNGEYALYPAGRHLRGAIGYIAFNLDLPISSKFLDFDFDDIIFRDLLPISKCGKIFYPEKNS
NSLKCPSCNEIYGSSVLRNIMARGLSYKEVIEGKKYRLSIIVKDEKYLNEMEAIIRYILSYGIYLGNKVSKGYGKFKIKE
YSIVDILVLLLSDAIEKDIVFSKKEISSSKFEIIRKRGKAKGDFGEIISL
The query sequence (length=210) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8yhd:G | 234 | 235 | 0.9810 | 0.8803 | 0.8766 | 2.56e-132 | 8yhe:G, 8z4j:G, 8z4l:G, 8z99:G, 8z9c:G |
2 | 8z9e:G | 175 | 201 | 0.8238 | 0.9886 | 0.8607 | 1.24e-104 | |
3 | 6tmf:W | 56 | 23 | 0.0381 | 0.1429 | 0.3478 | 3.7 | 6skf:Az, 6skg:Az, 6th6:Az |
4 | 3pr8:A | 218 | 48 | 0.0810 | 0.0780 | 0.3542 | 6.5 | 3pr8:B, 3pr8:C, 3pr8:D |
5 | 4c91:A | 811 | 90 | 0.1333 | 0.0345 | 0.3111 | 6.8 | |
6 | 6sw9:C | 61 | 27 | 0.0381 | 0.1311 | 0.2963 | 8.1 | 6swc:C, 6swd:C, 7zag:C, 7zah:C, 7zai:C, 7zhg:C |
7 | 7rcf:A | 290 | 37 | 0.0524 | 0.0379 | 0.2973 | 9.1 | 7rcc:D, 7rcc:A, 7rcc:G, 7rcd:A, 7rce:A, 7rcg:A |
8 | 5u75:A | 144 | 26 | 0.0571 | 0.0833 | 0.4615 | 9.4 |