MKCHRCGSDNVRKMVDSPVGDAWEVYVCEKCCYSWRSTENPVVMEKFKLDDNKIANMGVIPPI
The query sequence (length=63) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ae4:a | 67 | 63 | 1.0000 | 0.9403 | 1.0000 | 5.16e-43 | 7ae4:b, 7ae4:c, 7ae4:d, 7ae4:e, 7ae4:f, 7ae5:b, 7ae5:c, 7ae5:d, 7ae5:e, 7ae5:f, 7ae5:a, 7ae7:a, 7ae7:c, 7ae7:d, 7ae7:e, 7ae7:f |
2 | 8bjd:A | 208 | 25 | 0.1587 | 0.0481 | 0.4000 | 0.54 | 8bje:A, 8bk5:A, 2vcd:A |
3 | 6cnb:B | 1114 | 41 | 0.2540 | 0.0144 | 0.3902 | 0.77 | 8bws:B, 6cnc:B, 6cnd:B, 6cnf:B, 6eu0:B, 6eu1:B, 6f40:B, 6f41:B, 6f42:B, 6f44:B, 5fj8:B, 5fja:B, 6tut:B, 7z0h:B, 7z1l:B, 7z1m:B, 7z1n:B, 7z1o:B, 7z2z:B, 7z30:B, 7z31:B |
4 | 6vfr:A | 428 | 24 | 0.1587 | 0.0234 | 0.4167 | 2.0 | 6vfr:B |
5 | 4udg:B | 321 | 27 | 0.1587 | 0.0312 | 0.3704 | 2.1 | 4udg:A, 4udg:C, 4udg:D, 4udg:E, 4udg:F, 4udi:A, 4udi:B, 4udi:C, 4udi:D, 4udi:E, 4udi:F, 4udj:A, 4udj:B, 4udj:C, 4udj:D, 4udj:E, 4udj:F, 4udk:A, 4udk:B, 4udk:C, 4udk:D, 4udk:E, 4udk:F |
6 | 7xw9:R | 288 | 50 | 0.2381 | 0.0521 | 0.3000 | 3.6 | 7wkd:R, 7x1t:A, 7x1u:A |
7 | 3sur:A | 504 | 24 | 0.1429 | 0.0179 | 0.3750 | 3.6 | 3sus:A, 3sut:A, 3suu:A, 3suv:A, 3suw:A |
8 | 7pt6:9 | 341 | 35 | 0.2063 | 0.0381 | 0.3714 | 4.3 | 7pt6:I, 7pt7:9 |
9 | 8shj:A | 334 | 29 | 0.1429 | 0.0269 | 0.3103 | 5.2 | 8shj:B, 8t55:A, 8t55:B |
10 | 2jbs:D | 400 | 34 | 0.2222 | 0.0350 | 0.4118 | 5.5 | 2jbs:A, 2jbs:B, 2jbs:C, 2jbt:A, 2jbt:D, 2jbt:B, 2jbt:C |
11 | 8shj:C | 306 | 29 | 0.1429 | 0.0294 | 0.3103 | 6.3 | 8t55:C |
12 | 1qyp:A | 57 | 42 | 0.2222 | 0.2456 | 0.3333 | 6.7 | |
13 | 5j55:A | 480 | 20 | 0.1429 | 0.0187 | 0.4500 | 6.9 | 5j53:A, 5j54:A, 7qr6:A, 7qr6:B, 7qr6:C |
14 | 3cng:C | 178 | 29 | 0.1587 | 0.0562 | 0.3448 | 7.0 | 3cng:A, 3cng:B, 3cng:D |
15 | 5oh7:C | 82 | 46 | 0.1429 | 0.1098 | 0.1957 | 7.1 | |
16 | 6j0x:B | 466 | 31 | 0.2222 | 0.0300 | 0.4516 | 7.1 | 6j0w:A, 6j0w:B, 6j0x:A, 6j0x:C, 6j0x:D |
17 | 6xm7:A | 488 | 15 | 0.1270 | 0.0164 | 0.5333 | 8.2 | 6xm6:A, 6xm8:A, 6xm9:A, 6xma:A |