MKCHRCGSDNVRKMVDSPVGDAWEVYVCEKCCYSWRSTENPVVMEKFKLDDNKIANM
The query sequence (length=57) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 7ae4:a | 67 | 57 | 1.0000 | 0.8507 | 1.0000 | 1.77e-38 | 7ae4:b, 7ae4:c, 7ae4:d, 7ae4:e, 7ae4:f, 7ae5:b, 7ae5:c, 7ae5:d, 7ae5:e, 7ae5:f, 7ae5:a, 7ae7:a, 7ae7:c, 7ae7:d, 7ae7:e, 7ae7:f |
| 2 | 8bjd:A | 208 | 25 | 0.1754 | 0.0481 | 0.4000 | 0.43 | 8bje:A, 8bk5:A, 2vcd:A |
| 3 | 6cnb:B | 1114 | 41 | 0.2807 | 0.0144 | 0.3902 | 0.61 | 8bws:B, 6cnc:B, 6cnd:B, 6cnf:B, 6eu0:B, 6eu1:B, 6f40:B, 6f41:B, 6f42:B, 6f44:B, 5fj8:B, 5fja:B, 6tut:B, 7z0h:B, 7z1l:B, 7z1m:B, 7z1n:B, 7z1o:B, 7z2z:B, 7z30:B, 7z31:B |
| 4 | 3cng:C | 178 | 29 | 0.1754 | 0.0562 | 0.3448 | 1.0 | 3cng:A, 3cng:B, 3cng:D |
| 5 | 6vfr:A | 428 | 24 | 0.1754 | 0.0234 | 0.4167 | 1.6 | 6vfr:B |
| 6 | 7xw9:R | 288 | 50 | 0.2632 | 0.0521 | 0.3000 | 2.3 | 7wkd:R, 7x1t:A, 7x1u:A |
| 7 | 3sur:A | 504 | 24 | 0.1579 | 0.0179 | 0.3750 | 2.8 | 3sus:A, 3sut:A, 3suu:A, 3suv:A, 3suw:A |
| 8 | 5oh7:C | 82 | 46 | 0.1579 | 0.1098 | 0.1957 | 4.3 | |
| 9 | 5j55:A | 480 | 20 | 0.1579 | 0.0187 | 0.4500 | 4.7 | 5j53:A, 5j54:A, 7qr6:A, 7qr6:B, 7qr6:C |
| 10 | 6xm7:A | 488 | 15 | 0.1404 | 0.0164 | 0.5333 | 5.3 | 6xm6:A, 6xm8:A, 6xm9:A, 6xma:A |
| 11 | 7pt6:9 | 341 | 35 | 0.2281 | 0.0381 | 0.3714 | 5.6 | 7pt6:I, 7pt7:9 |
| 12 | 1qyp:A | 57 | 42 | 0.2456 | 0.2456 | 0.3333 | 6.1 | |
| 13 | 8jd6:R | 774 | 15 | 0.1404 | 0.0103 | 0.5333 | 9.0 | 7e9h:R, 7e9h:S, 8jd4:4, 8jd5:4, 8jd6:S |
umich.edu