BioLiP

>protein
MKAKEIIEFIETFAPKDLAIEGDNIGLQVGDNLDKEIKKLGIALDPSLSVIKKAEKEGVDFLFTHHPLLKDPIRNFTGVI
YKKLKILMENDIILYSAHTNLDICKNGLNDALAELYNLENPKPLYDNGLGRVGIFKGSFEEFLEITKKYIHKNPIVVKSK
EVDDNFKLAVLSGYGLSQSSIKYVAEKADVYLSGDLTHHSKILAEELGLVVVDATHYSTEVFGLKKFKEFLSSNLDLEII
SLDF

The query sequence (length=244) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3wse:A	248	244	1.0000	0.9839	1.0000	1.30e-175	3wsd:A, 3wsd:B, 3wsd:C, 3wsd:D, 3wsd:E, 3wsd:F, 3wse:B, 3wse:C, 3wse:D, 3wse:E, 3wse:F, 3wsf:A, 3wsf:B, 3wsf:C, 3wsf:D, 3wsf:E, 3wsf:F, 3wsg:A, 3wsg:B, 3wsg:C, 3wsg:D, 3wsg:E, 3wsg:F, 3wsh:A, 3wsh:B, 3wsh:C, 3wsh:D, 3wsh:E, 3wsh:F, 3wsh:G, 3wsh:H, 3wsh:I, 3wsh:J, 3wsh:K, 3wsh:L, 3wsi:A, 3wsi:B, 3wsi:C, 3wsi:D, 3wsi:E, 3wsi:F
2	2gx8:C	364	136	0.2254	0.1511	0.4044	1.92e-23	2gx8:A, 2gx8:B
3	2gx8:C	364	94	0.1311	0.0879	0.3404	0.004	2gx8:A, 2gx8:B
4	3lnl:A	307	296	0.2992	0.2378	0.2466	6.98e-16	2nyd:A
5	3lnl:B	349	124	0.1721	0.1203	0.3387	9.99e-13	2nyd:B
6	3lnl:B	349	60	0.0820	0.0573	0.3333	0.007	2nyd:B
7	1nmo:A	247	243	0.2459	0.2429	0.2469	1.38e-11	1nmo:B, 1nmo:C, 1nmo:D, 1nmo:E, 1nmo:F, 1nmp:A, 1nmp:B, 1nmp:C, 1nmp:D, 1nmp:E, 1nmp:F
8	6vjb:A	1346	82	0.1107	0.0201	0.3293	0.022
9	5xxz:B	1310	82	0.1107	0.0206	0.3293	0.023
10	5xya:A	1358	82	0.1107	0.0199	0.3293	0.024	5xxz:A
11	7edd:A	1394	82	0.1107	0.0194	0.3293	0.024	5xyr:A
12	6pv4:C	608	61	0.0779	0.0312	0.3115	0.97	6pv4:A, 6pv4:B, 6pv4:D
13	6mzm:B	968	34	0.0492	0.0124	0.3529	2.2	7egd:B, 7egh:B, 5fur:I
14	5el2:A	125	53	0.0861	0.1680	0.3962	3.9	5el2:B, 4fqt:A, 4fqt:B, 3n7h:A, 3n7h:B, 3ogn:A, 3ogn:B

[Back]