BioLiP

>protein
MIYGIGTDIVSLKRIIRLNKKFGQAFAGRILTPEELLEFPQAGKPVNYLAKRFAAKEAFAKAVGTGIRGAVSFRNIGIGH
DALGKPEFFYGPALSKWLEEQGISRVSLSMSDEEDTVLAFVVAEK

The query sequence (length=125) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5suv:A	126	125	1.0000	0.9921	1.0000	1.61e-88	5suv:B, 5suv:C
2	3qmn:E	127	125	0.4080	0.4016	0.4080	2.26e-27	3qmn:A, 3qmn:C, 3qmn:B, 3qmn:D, 3qmn:F, 3qmn:G, 3qmn:I, 3qmn:H, 3qmn:J, 3qmn:L, 3qmn:K, 3qmn:Q, 3qmn:M, 3qmn:N, 3qmn:O, 3qmn:P, 3qmn:R, 3qmn:S, 3qmn:U, 3qmn:T, 3qmn:V, 3qmn:W, 3qmn:X
3	5xuh:C	125	124	0.3920	0.3920	0.3952	8.62e-22	5vcb:c, 5vcb:B, 5vcb:M, 5vcb:U, 5vcb:S, 5xuh:B, 5xuh:A
4	2qg8:A	137	125	0.4000	0.3650	0.4000	2.93e-18
5	1f7l:A	118	87	0.3440	0.3644	0.4943	2.76e-16
6	7r49:B	121	131	0.4000	0.4132	0.3817	2.99e-16
7	3hyk:A	117	88	0.3200	0.3419	0.4545	6.60e-15	3hyk:B, 3hyk:C
8	1fth:A	117	127	0.3440	0.3675	0.3386	6.16e-11	1fth:B, 1fth:C
9	5xuk:A	115	119	0.3200	0.3478	0.3361	1.10e-07
10	3nfd:E	139	129	0.2880	0.2590	0.2791	0.005	3nfd:A, 3nfd:B, 3nfd:C, 3nfd:D, 3nfd:F
11	6jq8:A	225	45	0.1360	0.0756	0.3778	0.084
12	2jbz:A	124	123	0.2960	0.2984	0.3008	1.1	2wdo:A, 2wds:A, 2wdy:A
13	6ezn:F	650	61	0.1280	0.0246	0.2623	1.2	8agb:A, 8age:A, 6c26:A, 7oci:F
14	4v61:BD	227	66	0.2000	0.1101	0.3788	3.8
15	8agc:A	697	43	0.1040	0.0187	0.3023	5.6
16	3ej2:A	182	55	0.1280	0.0879	0.2909	5.8	3eiy:A, 3ej0:A
17	6t8y:BBB	375	21	0.0880	0.0293	0.5238	6.6	6t8y:AAA, 6t8y:CCC, 6t8y:DDD, 6t8z:AAA, 6t8z:BBB, 6t8z:CCC, 6t8z:DDD, 6t92:AAA, 6t92:BBB, 6t92:CCC, 6t92:DDD, 6t94:AAA, 6t94:BBB, 6t94:CCC, 6t94:DDD
18	6c80:B	486	47	0.1280	0.0329	0.3404	7.8	6c80:A
19	6iym:A	277	82	0.1600	0.0722	0.2439	8.6	6iym:B

[Back]