BioLiP

>protein
MISDTQIFIALILALVSLVLAIRLGRALYQ

The query sequence (length=30) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8wm6:M	30	30	1.0000	1.0000	1.0000	1.07e-13	8wmj:M, 8wmv:M, 8wmw:M, 7y7b:M, 7y8a:M
2	6l4u:M	30	30	0.6000	0.6000	0.6000	1.02e-06
3	7xqp:M	32	29	0.5333	0.5000	0.5517	2.96e-06	8htu:M, 7ksq:M, 7kux:M
4	7qco:T	31	29	0.5667	0.5484	0.5862	3.44e-06	6vpv:M, 6vpv:m, 6vpv:z
5	6igz:M	31	29	0.5667	0.5484	0.5862	1.16e-05
6	6kmw:aM	31	29	0.5000	0.4839	0.5172	1.71e-05	6kmw:bM, 6kmw:cM, 6kmx:aM, 6kmx:bM, 6kmx:cM
7	7yca:M	31	29	0.5000	0.4839	0.5172	1.77e-05
8	7a4p:M	31	29	0.5333	0.5161	0.5517	3.81e-05	6zzx:M, 6zzy:M
9	6k61:M	31	29	0.5333	0.5161	0.5517	4.39e-05	6jeo:aM, 6jeo:bM, 6jeo:cM, 6jeo:dM, 6k61:m, 7lx0:V, 7lx0:m, 7lx0:M, 6pnj:M, 6pnj:V, 6pnj:m, 6tcl:M1, 6tcl:M2, 6tcl:M, 6tcl:MM, 7y3f:M
10	4fe1:M	31	29	0.4667	0.4516	0.4828	7.94e-05	7fix:M1, 7fix:M2, 7fix:M3, 1jb0:M, 6k33:aM, 6k33:bM, 6k33:cM, 6lu1:M, 7m75:M, 7m76:M, 3pcq:M, 6pfy:M, 6pfy:V, 6pfy:i, 6pgk:M, 6pgk:V, 6tra:M, 6trc:M, 6trc:m, 6trc:y, 6trd:m, 6trd:y, 5zf0:M1, 5zf0:M2, 5zf0:M3, 5zf0:M4, 5zf0:M6, 5zf0:M5
11	7s3d:M	31	29	0.5333	0.5161	0.5517	2.33e-04	7s3d:V, 7s3d:m
12	8am5:m	31	29	0.5000	0.4839	0.5172	0.002	8asl:m, 8asp:m, 6hqb:M, 4kt0:M, 4l6v:M, 4l6v:m, 4l6v:7, 6nwa:M, 6nwa:m, 6nwa:V, 7o1v:M, 5oy0:M, 5oy0:m, 5oy0:9, 7umh:M, 7umh:V, 7umh:m, 6uzv:M, 6uzv:m, 6uzv:9
13	7y5e:MN	30	29	0.6667	0.6667	0.6897	0.008	7y5e:M2, 7y7a:M7, 7y7a:Mo
14	8jjr:m	79	28	0.4000	0.1519	0.4286	0.82
15	8jw0:m	89	28	0.3667	0.1236	0.3929	1.0

[Back]