MIRVYIALGSNLAMPLQQVSAAREALAHLPRSRLVACSPLYRTKPLGPQDQPDFLNAVVALDTSLPPEQLLDHTQAIERN
QGRVRKEQRWGPRTLDLDIMLYGDQVIKTDRLTIPHYGLKAREFMLYPLADIAPDLIFPDGESLSECLKRVDKNGLVLW
The query sequence (length=159) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2qx0:A | 159 | 159 | 1.0000 | 1.0000 | 1.0000 | 2.55e-116 | 2qx0:B |
2 | 5etl:D | 160 | 159 | 0.6226 | 0.6188 | 0.6226 | 3.55e-70 | 6an4:A, 6an6:A, 6an6:B, 1dy3:A, 1eqm:A, 5etk:A, 5etl:A, 5etl:B, 5etl:C, 5etm:A, 5etn:A, 5eto:A, 5etp:A, 1ex8:A, 4f7v:A, 1f9h:A, 1g4c:B, 3hd1:A, 3hd2:A, 1hq2:A, 3hsd:A, 3hsd:B, 3hsg:A, 3ht0:A, 3ilj:A, 3ilo:A, 3ip0:A, 7kdo:A, 7kdr:A, 3kuh:A, 4m5g:A, 4m5h:A, 4m5i:A, 4m5j:A, 4m5k:A, 4m5l:A, 4m5m:A, 4m5n:A, 4m5n:B, 1q0n:A, 1rao:A, 1rb0:A, 1rtz:A, 1ru1:A, 1ru1:B, 1ru2:A, 8sif:A, 1tmj:A, 1tmm:A, 1tmm:B, 3ud5:A, 3ude:A, 3udv:A |
3 | 1cbk:A | 160 | 157 | 0.5031 | 0.5000 | 0.5096 | 6.37e-57 | 1cbk:B |
4 | 8sk1:A | 162 | 155 | 0.3774 | 0.3704 | 0.3871 | 1.13e-32 | 8sk1:B |
5 | 3qbc:B | 161 | 139 | 0.3648 | 0.3602 | 0.4173 | 8.18e-32 | 4ad6:A, 4ad6:B, 4crj:A, 4cwb:A, 4cyu:A, 4cyu:B, 4cyu:C, 4cyu:D, 5etq:A, 5etq:B, 5etr:B, 5etr:A, 5ets:B, 5ets:A, 5ett:B, 5ett:A, 5etv:A, 3qbc:A |
6 | 8sl9:A | 422 | 134 | 0.2893 | 0.1090 | 0.3433 | 1.48e-19 | 4pzv:A |
7 | 3mco:A | 397 | 137 | 0.2893 | 0.1159 | 0.3358 | 2.92e-18 | 3mcn:B, 3mco:B |
8 | 3mcm:A | 368 | 134 | 0.2579 | 0.1114 | 0.3060 | 3.98e-13 | 3mcn:A |
9 | 2bmb:A | 513 | 156 | 0.2767 | 0.0858 | 0.2821 | 1.26e-12 | |
10 | 7ubz:D | 202 | 76 | 0.1447 | 0.1139 | 0.3026 | 2.6 | 7ubz:B |
11 | 3oth:A | 395 | 79 | 0.1447 | 0.0582 | 0.2911 | 2.6 | 3otg:A, 3oth:B |
12 | 7unr:f | 106 | 69 | 0.1069 | 0.1604 | 0.2464 | 3.5 | 8cd1:f, 6spc:f, 6spe:f, 6spf:f, 6spg:f, 7unu:f, 7unv:f, 7unw:f |
13 | 5n2i:A | 225 | 25 | 0.0818 | 0.0578 | 0.5200 | 3.6 | 5n2i:B, 5n2i:C, 5n2i:D |
14 | 9cys:A | 277 | 75 | 0.1447 | 0.0830 | 0.3067 | 4.0 | |
15 | 1fa2:A | 498 | 32 | 0.0692 | 0.0221 | 0.3438 | 5.0 | 5wqu:A |