BioLiP

>protein
MIPRVFIYRLPQDDPRKNTAIKLVRFGFAQLVDSIKALPSGSIILDPTVKTPLTPSDRVIAESRGLSLIDCSWKRAVDVH
TKFIRGKFIRRRLPLLIAANPTHYGKPYILSTIEAVAAALYIMGFKDEAMEVLRLYKWGPNFIIINQKYLERYAAGDLSP
ERELLGVDDVDNGLEQLMRVLTNG

The query sequence (length=184) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5apg:A	184	184	1.0000	1.0000	1.0000	3.17e-135	5apg:B, 5apg:C
2	8j4q:D	724	39	0.0652	0.0166	0.3077	3.4	8j4q:A, 8j4q:B, 8j4q:C, 8j4r:A, 8j4r:B, 8j4r:C, 8j4r:D, 6lfk:A, 6lfk:B, 6lfk:C, 6lfk:D
3	5ech:B	214	45	0.0707	0.0607	0.2889	3.7	5ech:C, 5ech:E, 5ech:F, 5eci:B, 5eci:C, 5eci:E, 5eci:F, 5eck:B, 5eck:C, 5eck:E, 5eck:F, 5ecl:B, 5ecl:C, 5ecl:E, 5ecl:F, 5ecm:B, 5ecm:C, 5ecm:E, 5ecm:F, 5ecn:B, 5ecn:C, 5ecn:E, 5ecn:F, 5eco:B, 5eco:C, 5eco:E, 5eco:F, 5ecp:B, 5ecp:C, 5ecp:E, 5ecp:F, 5ecq:B, 5ecq:C, 5ecq:E, 5ecq:F, 5ecr:B, 5ecr:C, 5ecr:E, 5ecr:F, 5ecs:A, 5ecs:B
4	7yj0:D	622	74	0.1250	0.0370	0.3108	4.0	7yj0:A, 7yj0:B, 7yj0:C
5	6d72:B	176	79	0.1467	0.1534	0.3418	4.6	6d72:A
6	4rul:A	823	35	0.0707	0.0158	0.3714	6.1	1cy1:A, 1cy2:A, 1cy4:A, 1cy6:A, 1cy7:A, 1cy8:A, 1mw8:X, 3px7:A
7	4q6x:A	278	22	0.0543	0.0360	0.4545	6.4
8	6p16:B	120	62	0.0924	0.1417	0.2742	8.8	6p16:A

[Back]