MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQSFIGRVFLFLMIVLPLWCGL
HRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI
The query sequence (length=119) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2b76:D | 119 | 119 | 1.0000 | 1.0000 | 1.0000 | 2.90e-82 | 2b76:P, 1kf6:D, 1kf6:P, 1kfy:D, 1kfy:P, 4kx6:D, 4kx6:P, 1l0v:D, 1l0v:P |
2 | 5hy5:A | 511 | 21 | 0.0840 | 0.0196 | 0.4762 | 1.9 | 5hy5:B |
3 | 5w7m:A | 273 | 39 | 0.1008 | 0.0440 | 0.3077 | 7.4 | |
4 | 6suk:A | 698 | 31 | 0.0840 | 0.0143 | 0.3226 | 7.6 | 4cth:A, 1dmt:A, 6gid:A, 5jmy:A, 5jmy:B, 2qpj:A, 1r1h:A, 1r1i:A, 1r1j:A, 6sh1:AAA, 6sh1:CCC, 6sh2:AAA, 6svy:A, 6thp:A, 6thp:B, 5v48:A, 5v48:B, 4xbh:A, 4xbh:B, 6xvp:A, 1y8j:A, 2yb9:A, 4zr5:A, 4zr5:B |
5 | 7p6u:A | 772 | 37 | 0.1176 | 0.0181 | 0.3784 | 9.2 | 7p6u:B, 7p6u:C, 7p6u:D, 7p6u:E |