MILGAVFYIVFIALFFGIAVGIIFAIKSIKLI
The query sequence (length=32) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2e74:E | 32 | 32 | 1.0000 | 1.0000 | 1.0000 | 2.28e-13 | 2e75:E, 4h0l:E, 4h13:E |
2 | 4h44:E | 31 | 27 | 0.4375 | 0.4516 | 0.5185 | 0.004 | 4ogq:E, 2zt9:E |
3 | 7r0w:M | 32 | 32 | 0.3438 | 0.3438 | 0.3438 | 1.1 | 7r0w:E, 7zxy:E, 7zxy:M |
4 | 7rjt:A | 902 | 28 | 0.3125 | 0.0111 | 0.3571 | 3.2 | 7rjt:B, 7rjt:C, 7rjt:D, 7rk6:A, 7rk6:B, 7rk6:C, 7rk6:D, 5tj6:A |