BioLiP

>protein
MIHLYDAKSFAKLRAAQYAAFHTDAPGSWFDHTSGVLESVEDGTPVLAIGVESGDAIVFDKNAQRIVAYKEKSVKAEDGS
VSVVQVENGFMKQGHRGWLVDLTGELVGCSPVVAEFGGHRYASGMVIVTGKGNSGKTPLVHALGEALGGKDKYATVRFGE
PLSGYNTDFNVFVDDIARAMLQHRVIVIDSLKNVIISRGAFDLLSDIGAMAASRGCVVIASLNPTSNDDKIVELVKEASR
SNSTSLVISTDVDGEWQVLTRTGEGLQALTHTLQTSYGEHSVLTIHTSQTVIKNDELESVLRRL

The query sequence (length=304) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4blt:A	305	305	0.9901	0.9869	0.9869	0.0	4blr:A, 4blr:B, 4blr:C, 4bls:A, 4bls:B, 4bls:C, 4blt:B, 4blt:C, 2vhc:A, 2vhc:C, 2vhc:B, 2vhj:A, 2vhj:B, 2vhj:C, 2vhq:A, 2vhq:B, 2vhq:C, 2vht:A, 2vht:B, 2vht:C, 2vhu:A, 2vhu:B, 2vhu:C, 1w44:A, 1w44:B, 1w44:C, 1w46:A, 1w46:B, 1w46:C, 1w47:A, 1w47:B, 1w47:C, 1w48:A, 1w48:B, 1w48:C, 1w49:A, 1w49:B, 1w49:C, 1w4a:A, 1w4a:B, 1w4a:C, 1w4b:A, 1w4b:B, 1w4b:C
2	6hyp:A	2272	170	0.1349	0.0180	0.2412	0.15
3	6qi8:A	317	94	0.0822	0.0789	0.2660	0.24	7aho:B, 6qi8:B, 6qi9:A, 6qi9:B
4	9ema:A	326	94	0.0822	0.0767	0.2660	0.31	7aho:A, 7aho:C, 2c9o:C, 9ema:B, 9ema:C, 9emc:A, 9emc:B, 9emc:C, 6fo1:A, 6fo1:B, 6fo1:C, 6k0r:A, 6k0r:B, 6k0r:C, 6k0r:G, 6k0r:H, 6k0r:I, 7p6x:A, 7p6x:B, 7p6x:C, 6qi8:C, 6qi9:C, 2xsz:A, 2xsz:B, 2xsz:C
5	2c9o:A	398	94	0.0822	0.0628	0.2660	0.35	2c9o:B
6	7zi4:C	447	94	0.0822	0.0559	0.2660	0.36	9c57:E, 9c57:C, 9c57:A, 9c62:C, 9c62:E, 9c62:A, 6hts:A, 6hts:C, 6hts:E, 5oaf:A, 5oaf:C, 5oaf:E, 8x15:M, 8x15:O, 8x15:Q, 8x19:M, 8x19:O, 8x19:Q, 8x1c:M, 8x1c:O, 8x1c:Q, 8xvg:A, 8xvg:C, 8xvg:E, 8xvt:A, 8xvt:C, 8xvt:E, 7zi4:A, 7zi4:E
7	7ole:C	427	94	0.0822	0.0585	0.2660	0.37	7ole:E
8	6j19:A	261	40	0.0395	0.0460	0.3000	1.0	6jd4:A, 6jd4:B
9	6cin:B	1169	51	0.0526	0.0137	0.3137	1.5	6cin:A, 6cin:C, 6cin:D, 6cin:E, 6cin:F, 6cio:A, 6cio:B, 6cio:C, 6cio:D, 6cio:E, 6cio:F, 6cip:A, 6cip:B, 6cip:C, 6cip:D, 6cip:E, 6cip:F, 6ciq:A, 6ciq:B, 6ciq:C
10	7uac:H	546	59	0.0559	0.0311	0.2881	1.7	7uab:E, 7uab:H, 7uae:A, 7uaf:B, 7uaf:A, 7uaf:C, 7uaf:D, 7uai:E, 7uai:B, 7uai:C, 7uai:D
11	3urm:A	329	58	0.0625	0.0578	0.3276	2.1	3urm:B, 3uug:A, 3uug:B
12	4xnh:A	786	72	0.0691	0.0267	0.2917	2.8	4hnw:A, 6o07:A, 4xpd:A, 4y49:G
13	4hnx:A	713	72	0.0691	0.0295	0.2917	2.9
14	5jcs:s	2003	48	0.0461	0.0070	0.2917	2.9
15	6hd7:t	838	72	0.0691	0.0251	0.2917	3.0
16	7si6:A	873	55	0.0592	0.0206	0.3273	3.6	7si3:A, 7si7:A
17	7xnt:C	320	145	0.1217	0.1156	0.2552	4.1
18	5n6n:C	698	64	0.0559	0.0244	0.2656	4.4	5m4a:A
19	6sml:B	911	80	0.0724	0.0241	0.2750	5.2	6sli:B, 6sli:D, 6sli:G, 6sli:J, 6slj:B, 6slj:A, 6sln:B, 6sln:A, 6sm3:B, 6smq:B, 6smq:E
20	7aih:At	165	22	0.0329	0.0606	0.4545	9.5	7am2:At, 7ane:At
21	3sqr:A	539	69	0.0691	0.0390	0.3043	9.9	3v9e:A, 4x4k:A

[Back]