BioLiP

>protein
MIHLYDAKSFAKLRAAQYAAFHTDAPGSWFDHTSGVLESVEDGTPVLAIGVESGDAIVFDKNAQRIVAYKEKSVKAEDGS
VSVVQVENGFMKQGHRGWLVDLTGELVGCSPVVAEFGGHRYASGMVIVTGKGNSGKTPLVHALGEALGGKDKYATVRFGE
PLSGYNTDFNVFVDDIARAMLQHRVIVIDSLKNVIISRGAFDLLSDIGAMAASRGCVVIASLNPTSNDDCIVELVKEASR
SNSTSLVISTDVDGEWQVLTRTGEGLQRLTHTLQTSYGEHSVLTIHTS

The query sequence (length=288) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4blt:A	305	288	0.9896	0.9344	0.9896	0.0	4blr:A, 4blr:B, 4blr:C, 4bls:A, 4bls:B, 4bls:C, 4blt:B, 4blt:C, 2vhc:A, 2vhc:C, 2vhc:B, 2vhj:A, 2vhj:B, 2vhj:C, 2vhq:A, 2vhq:B, 2vhq:C, 2vht:A, 2vht:B, 2vht:C, 2vhu:A, 2vhu:B, 2vhu:C, 1w44:A, 1w44:B, 1w44:C, 1w46:A, 1w46:B, 1w46:C, 1w47:A, 1w47:B, 1w47:C, 1w48:A, 1w48:B, 1w48:C, 1w49:A, 1w49:B, 1w49:C, 1w4a:A, 1w4a:B, 1w4a:C, 1w4b:A, 1w4b:B, 1w4b:C
2	6hyp:A	2272	172	0.1424	0.0180	0.2384	0.14
3	6qi8:A	317	94	0.0868	0.0789	0.2660	0.23	7aho:B, 6qi8:B, 6qi9:A, 6qi9:B
4	9ema:A	326	94	0.0868	0.0767	0.2660	0.29	7aho:A, 7aho:C, 2c9o:C, 9ema:B, 9ema:C, 9emc:A, 9emc:B, 9emc:C, 6fo1:A, 6fo1:B, 6fo1:C, 6k0r:A, 6k0r:B, 6k0r:C, 6k0r:G, 6k0r:H, 6k0r:I, 7p6x:A, 7p6x:B, 7p6x:C, 6qi8:C, 6qi9:C, 2xsz:A, 2xsz:B, 2xsz:C
5	2c9o:A	398	94	0.0868	0.0628	0.2660	0.33	2c9o:B
6	7zi4:C	447	94	0.0868	0.0559	0.2660	0.34	9c57:E, 9c57:C, 9c57:A, 9c62:C, 9c62:E, 9c62:A, 6hts:A, 6hts:C, 6hts:E, 5oaf:A, 5oaf:C, 5oaf:E, 8x15:M, 8x15:O, 8x15:Q, 8x19:M, 8x19:O, 8x19:Q, 8x1c:M, 8x1c:O, 8x1c:Q, 8xvg:A, 8xvg:C, 8xvg:E, 8xvt:A, 8xvt:C, 8xvt:E, 7zi4:A, 7zi4:E
7	7ole:C	427	94	0.0868	0.0585	0.2660	0.35	7ole:E
8	6j19:A	261	40	0.0417	0.0460	0.3000	1.0	6jd4:A, 6jd4:B
9	3urm:A	329	58	0.0660	0.0578	0.3276	1.7	3urm:B, 3uug:A, 3uug:B
10	7uac:H	546	59	0.0590	0.0311	0.2881	1.7	7uab:E, 7uab:H, 7uae:A, 7uaf:B, 7uaf:A, 7uaf:C, 7uaf:D, 7uai:E, 7uai:B, 7uai:C, 7uai:D
11	5jcs:s	2003	48	0.0486	0.0070	0.2917	2.6
12	5n6n:C	698	64	0.0590	0.0244	0.2656	2.9	5m4a:A
13	7si6:A	873	55	0.0625	0.0206	0.3273	4.1	7si3:A, 7si7:A
14	4a0f:A	746	189	0.1667	0.0643	0.2540	4.3
15	6cin:B	1169	51	0.0556	0.0137	0.3137	4.4	6cin:A, 6cin:C, 6cin:D, 6cin:E, 6cin:F, 6cio:A, 6cio:B, 6cio:C, 6cio:D, 6cio:E, 6cio:F, 6cip:A, 6cip:B, 6cip:C, 6cip:D, 6cip:E, 6cip:F, 6ciq:A, 6ciq:B, 6ciq:C
16	7xnt:C	320	144	0.1250	0.1125	0.2500	6.9
17	4a0g:D	709	179	0.1597	0.0649	0.2570	7.3
18	7yfr:B	643	46	0.0521	0.0233	0.3261	7.3	7yfr:D
19	4a0g:C	681	177	0.1597	0.0675	0.2599	7.4
20	7aih:At	165	22	0.0347	0.0606	0.4545	8.0	7am2:At, 7ane:At
21	3sqr:A	539	69	0.0729	0.0390	0.3043	8.3	3v9e:A, 4x4k:A
22	7bv5:A	234	34	0.0417	0.0513	0.3529	9.6	7bv5:B

[Back]