MHVTIEQAEKAIQAARAKAVELGTQMCIAIVDSGGNLKAFHRMDGAWVGSIDIAQKKAKTAVFFGMKTGQIGALSQPGGS
LYGIEHSNQGLITFPGGIPIVDADGEMSGAIGVSGSSVENDDAVALAGASAIGDTEL
The query sequence (length=137) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6c0z:A | 137 | 137 | 1.0000 | 1.0000 | 1.0000 | 1.14e-96 | 6c0z:C, 6c0z:D |
2 | 5cx7:E | 139 | 122 | 0.3358 | 0.3309 | 0.3770 | 2.72e-10 | 5cx7:A, 5cx7:B, 5cx7:C, 5cx7:D, 5cx7:F, 5cx7:G, 5cx7:H, 5cx7:I, 5cx7:J, 5cx7:K, 5cx7:L, 5cx7:M, 5cx7:N, 5cx7:O, 5cx7:P |
3 | 3fpv:A | 141 | 133 | 0.3358 | 0.3262 | 0.3459 | 7.24e-07 | 3fpv:B, 3fpv:C, 3fpv:D, 3fpv:E, 3fpv:G, 3fpv:F, 3fpv:H |
4 | 9bh5:AH | 192 | 36 | 0.1022 | 0.0729 | 0.3889 | 0.70 | 9cai:AH |
5 | 4hyv:A | 498 | 89 | 0.1971 | 0.0542 | 0.3034 | 0.94 | 4hyv:B, 4hyw:B, 4hyw:A, 4kct:B, 4kct:A, 4kcu:A, 4kcu:B, 4kcv:B, 4kcv:A, 4kcw:A, 4kcw:B |
6 | 8bja:A | 1563 | 26 | 0.0803 | 0.0070 | 0.4231 | 2.9 | |
7 | 6su2:A | 498 | 89 | 0.1752 | 0.0482 | 0.2697 | 4.1 | 6su2:B, 6su2:C, 6su2:D |
8 | 8om2:5 | 291 | 46 | 0.1241 | 0.0584 | 0.3696 | 6.2 | 8d8j:5, 8d8k:5, 8d8l:5, 8om3:5, 8om4:5 |
9 | 5mq6:A | 636 | 59 | 0.1460 | 0.0314 | 0.3390 | 8.9 |