MHQDYRELSLDELESVEKQTLRTIVQALQQYSKEAKSIFETTAADSSGEVIVLAEDITQYALEVAETYPINRRFAGFIDY
KRVRWLPSPHGLLPQVLLVDAKASTEKNRDTLQRSQLPMDAEFRNTSSGEVVTMEAGVIPHLMLQSANDGVLPAVTTSIF
VHFYYRELKDVEGRYRELKSIYVLSLPHARLKQRYNPDPDTSFFGAGKHSPARGEVARIRVYFDRLKEACPWRLQELHYS
ADSEYTQPRWRDLNDAGHEVTKEFLFLER
The query sequence (length=269) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2ezv:B | 269 | 269 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 2ezv:A, 2f03:A, 2f03:C |
2 | 8fkb:A | 424 | 38 | 0.0595 | 0.0377 | 0.4211 | 0.27 | 6cvc:A, 8fjo:A, 8flo:A, 8gdi:A |
3 | 8dty:A | 4004 | 101 | 0.1004 | 0.0067 | 0.2673 | 0.44 | 8dty:B, 8dty:C, 8dty:D |
4 | 6wou:A | 3921 | 101 | 0.1004 | 0.0069 | 0.2673 | 0.45 | 6wou:B, 6wou:C, 6wou:D, 6wov:A, 6wov:B, 6wov:C, 6wov:D |
5 | 8dvv:A | 3886 | 101 | 0.1004 | 0.0069 | 0.2673 | 0.46 | 8dvv:B, 8dvv:C, 8dvv:D |
6 | 8dtz:A | 4061 | 101 | 0.1004 | 0.0066 | 0.2673 | 0.47 | 8dtz:B, 8dtz:C, 8dtz:D |
7 | 6t0f:A | 431 | 38 | 0.0595 | 0.0371 | 0.4211 | 0.59 | 6t0f:B, 6t0f:C, 6t0f:D, 6t0g:A, 6t0h:A, 6t0j:A, 6t0k:A, 6t0l:A, 2wm4:A, 2wm5:A, 7zb9:A |
8 | 2y65:C | 343 | 43 | 0.0669 | 0.0525 | 0.4186 | 0.64 | 2y5w:A, 2y5w:B, 2y65:D, 2y65:B, 2y65:A |
9 | 7ua3:A | 4443 | 87 | 0.0855 | 0.0052 | 0.2644 | 1.4 | 7ua3:B, 7ua3:C, 7ua3:D, 7ua4:A, 7ua4:B, 7ua4:C, 7ua4:D |
10 | 5hv1:A | 847 | 25 | 0.0409 | 0.0130 | 0.4400 | 2.7 | 5hv3:A |
11 | 5fbs:A | 787 | 25 | 0.0409 | 0.0140 | 0.4400 | 2.7 | |
12 | 5fbt:A | 769 | 25 | 0.0409 | 0.0143 | 0.4400 | 2.8 | |
13 | 5fbu:A | 733 | 25 | 0.0409 | 0.0150 | 0.4400 | 3.1 | |
14 | 7eqh:A | 212 | 45 | 0.0595 | 0.0755 | 0.3556 | 3.3 | 7eqh:B |
15 | 1zl9:A | 207 | 84 | 0.0743 | 0.0966 | 0.2381 | 3.5 | 1zl9:B |
16 | 2f2g:A | 215 | 38 | 0.0520 | 0.0651 | 0.3684 | 3.8 | 2f2g:B, 2q4x:A, 2q4x:B |
17 | 7cka:A | 211 | 45 | 0.0632 | 0.0806 | 0.3778 | 4.4 | |
18 | 2cxx:A | 184 | 28 | 0.0446 | 0.0652 | 0.4286 | 5.3 | 2cxx:B, 2cxx:C |
19 | 6dre:A | 365 | 124 | 0.1190 | 0.0877 | 0.2581 | 5.8 | 6drh:C |
20 | 5z1a:A | 655 | 20 | 0.0409 | 0.0168 | 0.5500 | 8.6 | |
21 | 5hh9:A | 390 | 52 | 0.0632 | 0.0436 | 0.3269 | 9.0 | 5hh9:B, 5i90:A, 5i90:B |
22 | 6ffl:A | 383 | 52 | 0.0595 | 0.0418 | 0.3077 | 9.6 |