MHFNELRISQDNRFLIIDVSVDNQDYFEDVLLDSIVIDTQDTFVMNGPSDNPLYIYNVEDAYDTQQMKNVRLELNIQDLK
VSPCSTMFFVYVKSKGTPSTDTPCGFDKDQILGTVINLQPIYKQTLKYLKEVECDCNIPKGFIDMILKLKAIELCVRTGN
YPQAIKYWNKFFIKNNCKSPTSNCGCYG
The query sequence (length=188) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8ckb:THA016 | 188 | 188 | 1.0000 | 1.0000 | 1.0000 | 1.58e-139 | 8ckb:O011, 8ckb:O002, 8ckb:O013, 8ckb:O004, 8ckb:O019, 8ckb:O003, 8ckb:O006, 8ckb:O008, 8ckb:O015, 8ckb:O001, 8ckb:O010, 8ckb:O009, 8ckb:O012, 8ckb:O005, 8ckb:O014, 8ckb:O018, 8ckb:O023, 8ckb:O017, 8ckb:O020, 8ckb:O007, 8ckb:O022, 8ckb:O021, 8ckb:O024, 7qoj:H, 7qol:H, 7qol:G, 7qol:Z |
2 | 8w8g:C | 208 | 38 | 0.0585 | 0.0529 | 0.2895 | 5.5 | 3bqo:A, 8w8g:A, 8w8g:B, 8w8g:D, 5wir:B, 5wir:A, 5xup:A, 5xup:B |
3 | 6j11:F | 120 | 21 | 0.0532 | 0.0833 | 0.4762 | 6.2 | |
4 | 7rd0:A | 482 | 39 | 0.0798 | 0.0311 | 0.3846 | 6.2 | |
5 | 2sam:A | 99 | 59 | 0.0798 | 0.1515 | 0.2542 | 6.2 | 1siv:A, 1siv:B, 1tcw:A, 1tcw:B, 1yti:A, 1ytj:A |