BioLiP

>protein
MHCPFCRHPDSRVVDSRTTDDGTSIRRRRQCPDCSRRFTTVETCSLMVVKRSGVTEPFSRTKVINGVRKACQGRPVTEDA
LAQLGQRVEEAVRATGSAELTTHDVGLAILGPLQELDLVAYLRFASVYRAFDSLEDFEAAIAELRET

The query sequence (length=147) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7p37:A	147	147	1.0000	1.0000	1.0000	4.53e-106	7p37:E, 7p37:I, 7p37:C, 7p37:G, 7p37:K, 7p37:B, 7p37:F, 7p37:J, 7p37:D, 7p37:H, 7p37:L, 7p3f:A, 7p3f:C, 7p3f:B, 7p3f:D, 7p3q:A, 7p3q:C, 7p3q:D, 7p3q:E, 7p3q:F, 7p3q:G, 7p3q:B, 7p3q:H
2	2jne:A	71	46	0.0952	0.1972	0.3043	0.22
3	6j7u:A	247	42	0.1020	0.0607	0.3571	0.84	6j7u:B, 6j7u:C, 6j7u:D
4	3nyq:A	460	81	0.2041	0.0652	0.3704	0.89	3nyr:A
5	1gjq:A	541	41	0.1088	0.0296	0.3902	1.2	1bl9:A, 1bl9:B, 1gjq:B, 5guw:M, 5guw:N, 1hzu:A, 1hzv:A, 1n15:A, 1n15:B, 1n50:A, 1n50:B, 1n90:A, 1n90:B, 1nir:A, 1nir:B, 1nno:A, 1nno:B, 6tpo:A, 6tsi:A, 6tsi:B
6	6pek:D	293	69	0.1497	0.0751	0.3188	3.4	6pek:A, 6pek:B, 6pek:C, 6pek:E, 6pen:A, 6pen:B, 6pen:C, 6pen:D, 6pen:E, 5z6r:A
7	3jb9:A	1964	26	0.0680	0.0051	0.3846	4.3
8	6hiv:AE	293	23	0.0612	0.0307	0.3913	6.4	6hix:AE
9	1m7j:A	474	46	0.0952	0.0295	0.3043	6.7	1rjp:A, 1rjq:A, 1rjr:A, 1rk5:A, 1rk6:A, 1v4y:A, 1v51:A
10	7agj:A	731	46	0.1020	0.0205	0.3261	9.6	7agj:B

[Back]