MGNSGFYLYNTQNCVFADNTVQDILDKITTDPSLGLLKAFNNFPITNKIQCNGLFTPRNIETLLGGTEIGKFTVTPKSSG
SMFLVSADIIASRMEGGVVLALVREGDSKPYAISYGYSSGVPNLCSLRTRIINTGLTPTTYSLRVGGLESGVVWVNALSN
GNDILGITNTSNVSFLEVIPQ
The query sequence (length=181) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6gjt:E | 181 | 181 | 1.0000 | 1.0000 | 1.0000 | 8.88e-131 | 6gjt:A, 6gjt:B, 6gjt:C, 6gjt:D, 6gjt:F |
2 | 8wcn:A | 379 | 62 | 0.1160 | 0.0554 | 0.3387 | 0.15 | 8wcn:B |
3 | 7uxa:D | 264 | 59 | 0.1050 | 0.0720 | 0.3220 | 0.85 | 7zrz:CP1 |
4 | 8iss:D | 289 | 59 | 0.1050 | 0.0657 | 0.3220 | 0.95 | 8hmy:C, 8hmz:C |
5 | 2g02:A | 404 | 47 | 0.0884 | 0.0396 | 0.3404 | 2.3 | 2g0d:A |
6 | 4pyt:A | 302 | 155 | 0.2320 | 0.1391 | 0.2710 | 2.4 | |
7 | 1gm9:A | 207 | 63 | 0.0939 | 0.0821 | 0.2698 | 4.7 | 1fxh:A, 1fxv:A, 1k7d:A, 1kec:A |