MGNKQAKAPESKDSPRASLIPDATHLGPQFCKSCWFENKGLVECNNHYLCLNCLTLLLSVSNRCPICKMPLPTKLRPSAA
PTAPPTGAADSIRPPPYSP
The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2m1s:A | 99 | 99 | 1.0000 | 1.0000 | 1.0000 | 2.38e-69 | 7ckl:B, 7ela:B, 5i72:A, 5i72:B |
2 | 7x6v:B | 48 | 48 | 0.3232 | 0.6667 | 0.6667 | 3.88e-17 | |
3 | 7ckm:B | 49 | 47 | 0.2424 | 0.4898 | 0.5106 | 3.08e-10 | 7el9:B, 7el9:E, 7elb:B, 7elb:D, 7elc:B, 7vgq:B, 7vh1:B |
4 | 2ff0:A | 102 | 74 | 0.2020 | 0.1961 | 0.2703 | 0.22 | 2a66:A, 5l0m:A, 8pki:K |
5 | 7oik:A | 4426 | 36 | 0.1313 | 0.0029 | 0.3611 | 0.29 | 7oim:A, 6tax:A, 6tay:A |
6 | 6wi7:A | 206 | 53 | 0.1717 | 0.0825 | 0.3208 | 0.30 | 2ckl:A, 8grm:M, 2h0d:A, 7nd1:H, 8pp7:K, 8pp7:M, 4r8p:K, 4r8p:M, 3rpg:B, 6wi8:A, 6wi8:B |
7 | 6f98:A | 78 | 25 | 0.1111 | 0.1410 | 0.4400 | 1.2 | |
8 | 7r70:A | 150 | 29 | 0.1111 | 0.0733 | 0.3793 | 2.0 | 5d0i:A, 5d0i:B, 5d0k:C, 5d0k:F, 5d0k:I, 5d0k:L, 7r70:B, 7r71:A |
9 | 6zu5:SDD | 59 | 28 | 0.1010 | 0.1695 | 0.3571 | 2.1 | |
10 | 2djb:A | 72 | 54 | 0.1515 | 0.2083 | 0.2778 | 3.4 | |
11 | 2csy:A | 81 | 43 | 0.1313 | 0.1605 | 0.3023 | 3.4 | |
12 | 9biw:B | 528 | 17 | 0.1010 | 0.0189 | 0.5882 | 4.5 | 9biw:A |
13 | 2l0b:A | 91 | 76 | 0.2222 | 0.2418 | 0.2895 | 6.5 | |
14 | 1cyg:A | 680 | 34 | 0.1111 | 0.0162 | 0.3235 | 7.2 | |
15 | 7dvq:M | 191 | 55 | 0.1414 | 0.0733 | 0.2545 | 7.3 | 8i0r:K, 8i0s:K, 8i0t:K, 5z56:M, 5z58:M |