BioLiP

>protein
MGFEDMFAKKEGQWDCSSCLVRNEANATRCVACQNPDK

The query sequence (length=38) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7mns:B	38	38	1.0000	1.0000	1.0000	1.00e-23
2	7mnt:B	38	38	0.8158	0.8158	0.8158	2.45e-19	7mnt:D, 7mnu:B
3	7mnr:B	40	38	0.6316	0.6000	0.6316	2.52e-14
4	7mnp:B	39	33	0.5526	0.5385	0.6364	4.92e-11	7mnp:D, 7mnq:B
5	7mo2:B	38	35	0.4737	0.4737	0.5143	4.09e-09	3ch5:B, 7mo2:D
6	7mo5:B	36	31	0.4474	0.4722	0.5484	7.89e-09
7	7mnv:B	38	32	0.5263	0.5263	0.6250	9.85e-09
8	2ebq:A	47	25	0.3684	0.2979	0.5600	2.57e-06	2gqe:A, 2k0c:A
9	7mo3:B	38	34	0.3947	0.3947	0.4412	7.02e-06	7mo3:D, 7mo4:B, 7mo4:D
10	2ebv:A	57	35	0.3947	0.2632	0.4286	1.27e-05
11	2ebr:A	47	22	0.3158	0.2553	0.5455	1.13e-04
12	2d9g:A	53	23	0.3421	0.2453	0.5652	8.58e-04
13	7mo1:B	34	21	0.2368	0.2647	0.4286	0.017
14	8pp6:K	36	22	0.3158	0.3333	0.5455	0.018
15	3a9j:C	32	25	0.2368	0.2812	0.3600	0.18	9avt:C, 9avw:C, 7e62:C, 7e62:J, 2wwz:C, 2wx0:C, 2wx0:G, 2wx1:C
16	8adl:A	633	29	0.3421	0.0205	0.4483	0.22	8adl:I
17	4dno:A	297	32	0.2895	0.0370	0.3438	0.76	4dnf:A, 4dnf:B, 4dnf:C, 4dnf:D, 4dno:B, 4dno:C, 4dno:D, 4ehb:A, 4ehb:B, 4ehb:C, 4ehb:D, 4eus:B, 4eus:D, 5hk9:A, 5hk9:B, 5hk9:D, 5hka:A, 5hka:B, 5hka:C, 5hka:D, 5hkb:A, 5hkb:B, 5hkb:C, 5hkb:D, 5jyc:A, 5jyc:B, 5jyc:C, 5jyc:D, 5tnd:C, 5tnd:D, 5tnd:A, 5tnd:B, 5tne:A, 5tne:C, 5tnf:A, 5tnf:B, 5tnf:C, 5tnf:D, 5tng:A, 5tng:B, 5tng:C, 5tng:D, 5tnh:C, 5tnh:D, 5tnh:A, 5tnh:B, 5tni:A, 5tni:B, 5tni:C, 5tni:D, 5tnj:A, 5tnj:B, 5tnj:C, 5tnj:D, 5tnk:A, 5tnk:B, 5tnk:C, 5tnk:D, 5tnl:A, 5tnl:B, 5tnl:C, 5tnl:D, 5tnm:A, 5tnm:B, 5tnm:C, 5tnm:D, 5tnn:A, 5tnn:B, 5tnn:C, 5tnn:D, 5tnp:A, 5tnp:B, 5tnp:C, 5tnp:D, 5tnq:C, 5tnq:D, 5tnq:A, 5tnq:B, 5tnr:C, 5tnr:D, 5tnr:A, 5tnr:B, 5tns:D, 4yx9:A, 4yx9:B, 4yx9:C, 4yx9:D
18	6jk8:B	801	22	0.1842	0.0087	0.3182	2.1
19	6jk8:A	823	26	0.2105	0.0097	0.3077	2.4	1igr:A, 7v3p:B
20	7u5d:G	300	17	0.2368	0.0300	0.5294	2.9	7u5e:G
21	4y4v:A	316	15	0.2105	0.0253	0.5333	3.1	4y4v:B
22	7u5d:B	342	17	0.2368	0.0263	0.5294	3.2	7u5d:C, 7u5d:D, 7u5d:E, 7u5d:F, 7u5e:B, 7u5e:C, 7u5e:D, 7u5e:E, 7u5e:F
23	6hcz:A	65	21	0.2105	0.1231	0.3810	6.2	6hcz:B
24	6u04:A	168	25	0.2895	0.0655	0.4400	6.7	5erc:A
25	7dco:M	176	23	0.1842	0.0398	0.3043	6.8	5gm6:a

[Back]