MFSIRKIITISDYVTMLNIITGLLAILLNSFSLIYLSIIFDSLDGYVARKTGTVSDFGAELDSISDVVSFGVAPAYLLYN
NFESNLALISAIIFCLCGALRLARFGILNVKGFIGLPIPAGALLLVGFCQLINSYLINSILAILIGLLMISDIKYPKYPN
KIFIYIFAVSLCLAIVGIPHFALMLCLIYAIYGIIKYIRGDL
The query sequence (length=202) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7pow:B | 204 | 201 | 0.9950 | 0.9853 | 1.0000 | 9.02e-139 | 7b1k:A, 7b1k:B, 7b1l:A, 7b1l:B, 7b1n:A, 7b1n:B, 7pow:A |
2 | 6h5a:B | 209 | 47 | 0.0891 | 0.0861 | 0.3830 | 0.003 | 6h59:A, 6h59:B, 6h5a:A |
3 | 6wm5:A | 337 | 47 | 0.0842 | 0.0504 | 0.3617 | 0.18 | 6wm5:C, 6wmv:A, 6wmv:C |
4 | 7drj:A | 190 | 26 | 0.0594 | 0.0632 | 0.4615 | 0.70 | 7drj:B, 7drk:A, 7drk:B |
5 | 8ero:A | 364 | 84 | 0.1139 | 0.0632 | 0.2738 | 1.1 | 8ero:B, 8erp:B, 8erp:A |
6 | 1lj8:A | 492 | 35 | 0.0594 | 0.0244 | 0.3429 | 2.8 | 1m2w:A, 1m2w:B |
7 | 3mmr:A | 308 | 40 | 0.0842 | 0.0552 | 0.4250 | 5.0 | 3sl0:A, 3sl1:A |
8 | 6yra:B | 579 | 54 | 0.0842 | 0.0294 | 0.3148 | 5.1 | 6yra:D |